Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 103 (22 Apr 2020)
Sequence version 3 (03 Jul 2019)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Apolipoprotein B receptor

Gene

APOBR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out of the context of the macrophage. May provide essential lipids to reticuloendothelial cells. Could also be involved in foam cell formation with elevated TRL and remnant lipoprotein (RLP). Mediates the rapid high-affinity uptake of chylomicrons (CM), HTG-VLDL, and trypsinized (tryp) VLDL devoid of APOE in vitro in macrophages.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processCholesterol metabolism, Lipid metabolism, Lipid transport, Steroid metabolism, Sterol metabolism, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8964046 VLDL clearance

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Apolipoprotein B receptorCurated
Alternative name(s):
Apolipoprotein B-100 receptor
Apolipoprotein B-48 receptor
Short name:
Apolipoprotein B48 receptor
Short name:
apoB-48R
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:APOBRImported
Synonyms:APOB48R
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24087 APOBR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605220 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q0VD83

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Chylomicron, LDL, Membrane, VLDL

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Atherosclerosis

Organism-specific databases

DisGeNET

More...
DisGeNETi
55911

Open Targets

More...
OpenTargetsi
ENSG00000184730

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q0VD83 Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB14003 alpha-Tocopherol acetate
DB09130 Copper
DB11635 Tocofersolan
DB11251 Tocopherol
DB01593 Zinc
DB14487 Zinc acetate
DB14533 Zinc chloride

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
APOBR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
519668661

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003272631 – 1097Apolipoprotein B receptorAdd BLAST1097

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei458PhosphoserineBy similarity1
Modified residuei510PhosphoserineCombined sources1
Modified residuei572PhosphothreonineCombined sources1
Modified residuei594PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

There are 2 forms in macrophages, the membrane-binding proteins 200 kDa (MBP 200) and 235 kDa (MBP 235), that can be reduced into a single active ligand-binding species with intermediate mobility (MBP 200R).1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q0VD83

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q0VD83

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q0VD83

PeptideAtlas

More...
PeptideAtlasi
Q0VD83

PRoteomics IDEntifications database

More...
PRIDEi
Q0VD83

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
42868
58813 [Q0VD83-2]
58814 [Q0VD83-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q0VD83

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q0VD83

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in peripheral blood leukocytes > bone marrow = spleen > lymph node, and only faintly visible in appendix and thymus. Expressed in the brain, heart, kidney, liver, lung, pancreas, and placenta. Expressed primarily by reticuloendothelial cells: monocytes, macrophages, and endothelial cells. Expressed in atherosclerotic lesion foam cells.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Suppressed significantly by PPARA and PPARG in THP-1 and blood-borne monocyte-macrophages. Decreased after pitavastatin treatment in peripheral blood macrophages and remnant lipoprotein (RLP)-induced foam cell formation.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184730 Expressed in blood and 104 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q0VD83 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000184730 Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q0VD83, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000457539

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q0VD83 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi158 – 970Glu-richAdd BLAST813

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J3HP Eukaryota
ENOG410XRQZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000065031

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006101_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q0VD83

Identification of Orthologs from Complete Genome Data

More...
OMAi
WGGLTHR

Database of Orthologous Groups

More...
OrthoDBi
248102at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q0VD83

TreeFam database of animal gene trees

More...
TreeFami
TF337147

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026158 ApolipoprotB_rcpt

The PANTHER Classification System

More...
PANTHERi
PTHR15964 PTHR15964, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 4 (identifier: Q0VD83-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFLRLYLPG LHQALRGALD SLGTFVSYLL GDAVPTVERE AQAAEELGVV
60 70 80 90 100
AVGKTGKIVE EEAQEDLEGL RGSQNEGAGR LRGPGDDRRH EVGSSAVEQT
110 120 130 140 150
WGWGDGSSHG SQAERQDSGA GETAKAARCQ EPSAHLEARK KSKAGSGACQ
160 170 180 190 200
DRSGQAQERQ ESHEQEVNRE ERLRSWEQEE EEEEVRAREP GMARGAESEW
210 220 230 240 250
TWHGETEGKA GAVGPKAAGD NREMEQGVRE ADAGETEEPG AEGAGKGEEV
260 270 280 290 300
VVVEKACEST RAWGTWGPGA EPEDWGILGR EEARTTPGRE EARAILDGEE
310 320 330 340 350
ARTISGGEEA ETASGGEEAE TASGGEEAGT ASGGEEAGIA SGGEAGTASG
360 370 380 390 400
GEEAGTASGG EEAGTASGGD EAWTTSGKEE ADLLGVRQTE YGAVPGERLL
410 420 430 440 450
EATGKVWVLE EEGDEEREAE VSPFPKQPQV LGTERTEEAA ESQTAGREAV
460 470 480 490 500
GGQEAGESFE GQVDLRGKEA EMRQDLGIRA DRARMEELVQ AEEAQEERGS
510 520 530 540 550
SRDPVAELPS DGEAEGTADL EATPEARPEE ELTGEESEAA QTSCGLLGVE
560 570 580 590 600
WGGLTHSVTK GQGPELMGGA QTPTKQPEER EAGEVELMGV LALSKEEQER
610 620 630 640 650
SLEAGPRHAG SVKPEASEAF PGAWENRTRK DMERGNTQED AADGEQREEE
660 670 680 690 700
ETAGGQTLAA EAEGDRESEL SEVPEAGGEG LTTQDAGCGT EEGEASVSEN
710 720 730 740 750
QELDGSTGAD AGPCPSLGEA YARETEDEEA EADRTSRRGW RLQAVAVGLP
760 770 780 790 800
DREDAQTGSV AAGIMGGDVV PHISAAGAGE ALEGVLGQGW DSKEKEEAAA
810 820 830 840 850
GEHAGGQEFG LEGSAEEEVT GRGSQVEAFE SREGGPWGGR VEAEESAGAE
860 870 880 890 900
DSCGLDPAGS QTARAEGMGA MVEAGGLLEK WTLLEEEAVG WQEREQREDS
910 920 930 940 950
EGRCGDYHPE GEAPRLLDAE GLMVTGGRRA EAKETEPESL EHVRGQEEQP
960 970 980 990 1000
THQAPAEAAP ESVGEAETAE AMGSARGGAA NSWSEAPLPG SLLDVSVPRS
1010 1020 1030 1040 1050
RVHLSRSSSQ RRSRPSFRRT PAWEQQEEPP APNPPEEELS APEQRPLQLE
1060 1070 1080 1090
EPLEPSPLRH DGTPVPARRR PLGHGFGLAH PGMMQELQAR LGRPKPQ
Length:1,097
Mass (Da):115,634
Last modified:July 3, 2019 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i55BADDAD96EB16E1
GO
Isoform 2 (identifier: Q0VD83-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-471: Missing.

Show »
Length:626
Mass (Da):66,335
Checksum:iCD3C36057E9603F5
GO
Isoform 3 (identifier: Q0VD83-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1056-1097: SPLRHDGTPVPARRRPLGHGFGLAHPGMMQELQARLGRPKPQ → RWEDRLRPGVRDQPGQHSKIPIF

Show »
Length:1,078
Mass (Da):113,801
Checksum:i6A10C2B6B5A3EACA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A4V7I447A0A4V7I447_HUMAN
Apolipoprotein B receptor
APOBR
1,088Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti340A → S in AAF76255 (PubMed:10852956).Curated1
Sequence conflicti340A → S in AAF76256 (PubMed:10852956).Curated1
Sequence conflicti390E → Q in AAF76255 (PubMed:10852956).Curated1
Sequence conflicti390E → Q in AAF76256 (PubMed:10852956).Curated1
Sequence conflicti785V → A in AAF76255 (PubMed:10852956).Curated1
Sequence conflicti785V → A in AAF76256 (PubMed:10852956).Curated1
Sequence conflicti785V → A in AAI19787 (PubMed:15489334).Curated1
Sequence conflicti785V → A in AAI19789 (PubMed:15489334).Curated1
Sequence conflicti785V → A in AK075085 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081733352 – 360Missing 2 PublicationsCorresponds to variant dbSNP:rs148114931Ensembl.9
Natural variantiVAR_042432428P → A3 PublicationsCorresponds to variant dbSNP:rs180743Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0601931 – 471Missing in isoform 2. Add BLAST471
Alternative sequenceiVSP_0601941056 – 1097SPLRH…RPKPQ → RWEDRLRPGVRDQPGQHSKI PIF in isoform 3. Add BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF141332 mRNA Translation: AAF76255.1
AF141333 Genomic DNA Translation: AAF76256.1
AC138894 Genomic DNA No translation available.
BC119786 mRNA Translation: AAI19787.1
BC119788 mRNA Translation: AAI19789.1
AK075085 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58442.1 [Q0VD83-4]

NCBI Reference Sequences

More...
RefSeqi
NP_061160.3, NM_018690.3 [Q0VD83-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000564831; ENSP00000457539; ENSG00000184730 [Q0VD83-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55911

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55911

UCSC genome browser

More...
UCSCi
uc002dqb.2 human [Q0VD83-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141332 mRNA Translation: AAF76255.1
AF141333 Genomic DNA Translation: AAF76256.1
AC138894 Genomic DNA No translation available.
BC119786 mRNA Translation: AAI19787.1
BC119788 mRNA Translation: AAI19789.1
AK075085 mRNA No translation available.
CCDSiCCDS58442.1 [Q0VD83-4]
RefSeqiNP_061160.3, NM_018690.3 [Q0VD83-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ0VD83, 2 interactors
STRINGi9606.ENSP00000457539

Chemistry databases

DrugBankiDB14003 alpha-Tocopherol acetate
DB09130 Copper
DB11635 Tocofersolan
DB11251 Tocopherol
DB01593 Zinc
DB14487 Zinc acetate
DB14533 Zinc chloride

PTM databases

iPTMnetiQ0VD83
PhosphoSitePlusiQ0VD83

Polymorphism and mutation databases

BioMutaiAPOBR
DMDMi519668661

Proteomic databases

jPOSTiQ0VD83
MassIVEiQ0VD83
PaxDbiQ0VD83
PeptideAtlasiQ0VD83
PRIDEiQ0VD83
ProteomicsDBi42868
58813 [Q0VD83-2]
58814 [Q0VD83-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26469 221 antibodies

Genome annotation databases

EnsembliENST00000564831; ENSP00000457539; ENSG00000184730 [Q0VD83-4]
GeneIDi55911
KEGGihsa:55911
UCSCiuc002dqb.2 human [Q0VD83-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55911
DisGeNETi55911

GeneCards: human genes, protein and diseases

More...
GeneCardsi
APOBR
HGNCiHGNC:24087 APOBR
HPAiENSG00000184730 Tissue enhanced (lymphoid)
MIMi605220 gene
neXtProtiNX_Q0VD83
OpenTargetsiENSG00000184730

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J3HP Eukaryota
ENOG410XRQZ LUCA
GeneTreeiENSGT00530000065031
HOGENOMiCLU_006101_0_0_1
InParanoidiQ0VD83
OMAiWGGLTHR
OrthoDBi248102at2759
PhylomeDBiQ0VD83
TreeFamiTF337147

Enzyme and pathway databases

ReactomeiR-HSA-8964046 VLDL clearance

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
APOBR human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55911
PharosiQ0VD83 Tbio

Protein Ontology

More...
PROi
PR:Q0VD83
RNActiQ0VD83 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184730 Expressed in blood and 104 other tissues
GenevisibleiQ0VD83 HS

Family and domain databases

InterProiView protein in InterPro
IPR026158 ApolipoprotB_rcpt
PANTHERiPTHR15964 PTHR15964, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAPOBR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q0VD83
Secondary accession number(s): H3BU97
, Q0VD81, Q8NC15, Q9NPJ9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: July 3, 2019
Last modified: April 22, 2020
This is version 103 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again