Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 108 (23 Feb 2022)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Kinase non-catalytic C-lobe domain-containing protein 1

Gene

Kndc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RAS-Guanine nucleotide exchange factor (GEF) that controls the negative regulation of neuronal dendrite growth by mediating a signaling pathway linking RAS and MAP2 (PubMed:17984326, PubMed:21385318).

May be involved in cellular senescence (By similarity).

By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinase non-catalytic C-lobe domain-containing protein 1Imported
Short name:
KIND domain-containing protein 1Curated
Alternative name(s):
Protein very KIND1 Publication
Short name:
v-KIND1 Publication
Ras-GEF domain-containing family member 2Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kndc1Imported
Synonyms:Kiaa1768, Rasgef2, Vkind1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1923734, Kndc1

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000066129

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi461L → A: Abolishes interaction with MAP2. 1 Publication1
Mutagenesisi474L → A: Abolishes interaction with MAP2. 1 Publication1
Mutagenesisi477L → A: Abolishes interaction with MAP2. 1 Publication1
Mutagenesisi482L → A: No effect on interaction with MAP2. 1 Publication1
Mutagenesisi485L → A: No effect on interaction with MAP2. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003071421 – 1742Kinase non-catalytic C-lobe domain-containing protein 1Add BLAST1742

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei267PhosphoserineCombined sources1
Modified residuei951PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-4014

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q0KK55

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q0KK55

PeptideAtlas

More...
PeptideAtlasi
Q0KK55

PRoteomics IDEntifications database

More...
PRIDEi
Q0KK55

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
297602 [Q0KK55-1]
297603 [Q0KK55-2]
297604 [Q0KK55-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q0KK55

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q0KK55

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the brain and at low levels in the ovary. In the brain it is most prominently expressed in the cerebellum where it is restricted to the granular Purkinje cell layer.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At 14.5 dpc, highly expressed in the mid- and hindbrain and only weakly in the forebrain, but during development the main expression shifts towards the telencephalon as seen at 17.5 dpc (PubMed:16099729). In cerebellum expression is highly up-regulated between postnatal days P7 and P12. At P7, low expression levels throughout the brain, but high in hippocampus, thalamus and the cerebellar white matter (PubMed:17984326).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000066129, Expressed in lumbar subsegment of spinal cord and 156 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q0KK55, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via KIND2) with MAP2; the interaction enhances MAP2 phosphorylation and localizes KNDC1 to dendrites.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
218148, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q0KK55, 1 interactor

Molecular INTeraction database

More...
MINTi
Q0KK55

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000050586

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q0KK55, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q0KK55

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 217KIND 1PROSITE-ProRule annotationAdd BLAST181
Domaini456 – 620KIND 2PROSITE-ProRule annotationAdd BLAST165
Domaini1239 – 1367N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST129
Domaini1461 – 1712Ras-GEFPROSITE-ProRule annotationAdd BLAST252

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni215 – 288DisorderedSequence analysisAdd BLAST74
Regioni365 – 455DisorderedSequence analysisAdd BLAST91
Regioni703 – 727DisorderedSequence analysisAdd BLAST25
Regioni744 – 876DisorderedSequence analysisAdd BLAST133
Regioni948 – 1006DisorderedSequence analysisAdd BLAST59
Regioni1028 – 1076DisorderedSequence analysisAdd BLAST49

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1112 – 1177Sequence analysisAdd BLAST66

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi399 – 416Polar residuesSequence analysisAdd BLAST18
Compositional biasi423 – 444Basic and acidic residuesSequence analysisAdd BLAST22
Compositional biasi781 – 797Polar residuesSequence analysisAdd BLAST17
Compositional biasi948 – 976Polar residuesSequence analysisAdd BLAST29
Compositional biasi1042 – 1056Polar residuesSequence analysisAdd BLAST15

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QSHW, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011408

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003380_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q0KK55

Identification of Orthologs from Complete Genome Data

More...
OMAi
YWDEQLL

Database of Orthologous Groups

More...
OrthoDBi
78094at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q0KK55

TreeFam database of animal gene trees

More...
TreeFami
TF336009

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06224, REM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.840.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR011019, KIND_dom
IPR029899, KNDC1
IPR000651, Ras-like_Gua-exchang_fac_N
IPR023578, Ras_GEF_dom_sf
IPR001895, RASGEF_cat_dom
IPR036964, RASGEF_cat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR21560, PTHR21560, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16474, KIND, 1 hit
PF00617, RasGEF, 1 hit
PF00618, RasGEF_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00750, KIND, 2 hits
SM00147, RasGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48366, SSF48366, 1 hit
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51377, KIND, 2 hits
PS50009, RASGEF_CAT, 1 hit
PS50212, RASGEF_NTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q0KK55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAMDPASRG FYEEDGKDLD FYDFEPLPTL PEDEENVSLA DILSLRDRGL
60 70 80 90 100
SEQEAWAVCL ECSLSMRSVA HAAIFQTLCI TPDTLAFNTS GNVCFMEQLS
110 120 130 140 150
DDPEGAFVPP EFDLTGNTFE AHIYSLGATL KAALEYVPEP ELEPKLSTDL
160 170 180 190 200
EGLLSQMQAE DPRERPDLAS IIALCEEKMQ PVSSCRLCRS LSAIGRRVLS
210 220 230 240 250
IESFGAFQEL SENTWRGRPA PRNVGPKKMP GDLSTDPEAL FPSKGLLQPP
260 270 280 290 300
ASRDAEQEAG QRPRAPSPKP LLSAPVRNGE NPGQEGLADL VLDARCPLGE
310 320 330 340 350
LDRDNLRRSR LKKAQTFPRL LQESTETSTL CLSLNGSRNQ LAISEFFPPD
360 370 380 390 400
PRKLFLEGKN GLSGFKTQSK SRLWPEQEPG VQLDKTPGAG RNPHRSPGAS
410 420 430 440 450
GQLEASSPSQ GSVEYKPSPS PVDAGDSDHE GHIPRSEEKI PEESRQPGST
460 470 480 490 500
ATEQSLSLKD LLSKLGRPFR EYELWALCLS CLSTLQTHKE HPAHLCLDNV
510 520 530 540 550
LVAEDGTVFF GPPPANGAYN SLFLAPEVSE EKLVTEKASV YCVAAVLWTA
560 570 580 590 600
AKFSVPRDHK LALPRRLKTL LLDMARRHAS ERPSAAEAIK VCSSYLLQRG
610 620 630 640 650
MDSSKILAHL RASTCKVHPE EETIGLQNAF SVVELKSTTA PAPESSPGFL
660 670 680 690 700
QVSNDTKLVA VPGPVPGLPP CCKEACELPA AFTSEATHFK PIVLAQDASV
710 720 730 740 750
TRDQLALPSE SNEKPKEGSG HLDREGTRKQ AALELVEATD LKMSNQLSPG
760 770 780 790 800
PELQGATPDP DGDSGSPSSA TECSCPHGPA LVTQQKGTSG TPSSPASSLP
810 820 830 840 850
PEHRPDGEGP LGTTVLPGPT SASQGSRHPC KPPRGKAAAS PSSPRGSDGH
860 870 880 890 900
PEKPRPADRK LCPSSVDTSS PPKMTACPSL QEAMRLIQEE FAFDGYMDNG
910 920 930 940 950
LEALIMGEYI YALKDLTFAT FCGAISEKFC DLYWDEQLLK NLFKVVNGPA
960 970 980 990 1000
SPSESTSEEP GSQPEHSPSR CSLSSKRPSL HGLGKEKPAT TWGSGGPCSP
1010 1020 1030 1040 1050
TALSDIDSDT LSQGNFEVGF RSQKSIKVTR EQQPEAEVGG QPGPSQDSTS
1060 1070 1080 1090 1100
HASDTVARLA RSEDGGPAGS PGASDFQNCS PGWSSAFYEA DCFGADVYNY
1110 1120 1130 1140 1150
VKDLERQKTN GHTELEAQSP ELEQQLMIEK RNYRKTLKFY QKLLQKEKRN
1160 1170 1180 1190 1200
KGSEVRTMLS KLRGQLDEMK SKVQFLSLVK KYLQVMYAER WGLEPCALPV
1210 1220 1230 1240 1250
IVNIAAAPCD TLDFSPLDES SSLIFYNVNK HPGSGRQKKA RILQAGTPLG
1260 1270 1280 1290 1300
LMAYLYSSDA FLEGYVQQFL YTFRYFCTPH DFLHFLLDRI SSTLSRAHQD
1310 1320 1330 1340 1350
PTSTFTKIYR RSLCVLQAWV EDCYTVDFIR NAGLLGQLED FISSKILPLD
1360 1370 1380 1390 1400
GTAEHLLALL EVGTERRADS ASRGADLEDP KEAEEDTRPF NALCKRFSED
1410 1420 1430 1440 1450
GITRKSFSWR LPRGNGLVLP HHKERQYTIA SALPKPCFFE DFYGPYAKAS
1460 1470 1480 1490 1500
EKGPYFLTEY STNQLFTQLT LLQQELFQKC HPVHFLNSRA LGVMDKSAAI
1510 1520 1530 1540 1550
PKASSSESLS AKTCSLFLPN YVQDKYLLQL LRNADDVSTW VAAEIVTSHT
1560 1570 1580 1590 1600
SKLQVNLLSK FLLIAKSCYE QRNFATAMQI LGGLEHLAVR QSPAWRILPA
1610 1620 1630 1640 1650
KIAEVMEELK AVEVFLKSDS LCLMEGRRFR AQPTLPSAHL LAMHIQQLET
1660 1670 1680 1690 1700
GGFTMTNGAH RWSKLRNIAK VASQVHAFQE NPYTFSPDPK LQAHLKQRIA
1710 1720 1730 1740
RFSGADVSIL AADNRANFHQ IPGEKHSRKI QDKLRRMKAT FQ
Length:1,742
Mass (Da):191,313
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2C54217F515FA984
GO
Isoform 2 (identifier: Q0KK55-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-572: ASVYCVAAVLWTAAKFSVPRDHKLALPRRLKTLLL → VTSHITSLAPSSPSAQWIAGPDGLNVAPILLAGLL
     573-1742: Missing.

Show »
Length:572
Mass (Da):62,270
Checksum:i66ACFDB2890AAFA1
GO
Isoform 3 (identifier: Q0KK55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.

Show »
Length:616
Mass (Da):70,144
Checksum:i63C5E20CEA1B89CD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z3X0D3Z3X0_MOUSE
Kinase non-catalytic C-lobe domain-...
Kndc1
572Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC41157 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti20D → G in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti154L → V in BAC41157 (PubMed:16141072).Curated1
Sequence conflicti253R → E in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti289D → G in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti310R → Q in BAF03205 (PubMed:16807365).Curated1
Sequence conflicti427S → L in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti431G → C in BAE27853 (PubMed:16141072).Curated1
Sequence conflicti440I → T in BAE28078 (PubMed:16141072).Curated1
Sequence conflicti780A → V in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti812G → D in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti836K → R in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti845R → G in BAE28064 (PubMed:16141072).Curated1
Sequence conflicti957S → N in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti1109T → A in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti1109T → A in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti1209C → F in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti1306T → A in CAE30489 (PubMed:16099729).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0285991 – 1126Missing in isoform 3. 1 PublicationAdd BLAST1126
Alternative sequenceiVSP_028600538 – 572ASVYC…KTLLL → VTSHITSLAPSSPSAQWIAG PDGLNVAPILLAGLL in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_028601573 – 1742Missing in isoform 2. 1 PublicationAdd BLAST1170

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ580324 mRNA Translation: CAE30489.2
AB257857 mRNA Translation: BAF03200.1
AB257862 Genomic DNA Translation: BAF03205.1
AK046817 mRNA Translation: BAC32882.1
AK090282 mRNA Translation: BAC41157.1 Frameshift.
AK147335 mRNA Translation: BAE27853.1
AK147672 mRNA Translation: BAE28064.1
AK147693 mRNA Translation: BAE28078.1
AK169316 mRNA Translation: BAE41071.1

NCBI Reference Sequences

More...
RefSeqi
NP_796235.4, NM_177261.4 [Q0KK55-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000053445; ENSMUSP00000050586; ENSMUSG00000066129 [Q0KK55-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
76484

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:76484

UCSC genome browser

More...
UCSCi
uc009kgd.1, mouse [Q0KK55-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580324 mRNA Translation: CAE30489.2
AB257857 mRNA Translation: BAF03200.1
AB257862 Genomic DNA Translation: BAF03205.1
AK046817 mRNA Translation: BAC32882.1
AK090282 mRNA Translation: BAC41157.1 Frameshift.
AK147335 mRNA Translation: BAE27853.1
AK147672 mRNA Translation: BAE28064.1
AK147693 mRNA Translation: BAE28078.1
AK169316 mRNA Translation: BAE41071.1
RefSeqiNP_796235.4, NM_177261.4 [Q0KK55-1]

3D structure databases

SMRiQ0KK55
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi218148, 3 interactors
IntActiQ0KK55, 1 interactor
MINTiQ0KK55
STRINGi10090.ENSMUSP00000050586

PTM databases

iPTMnetiQ0KK55
PhosphoSitePlusiQ0KK55

Proteomic databases

CPTACinon-CPTAC-4014
MaxQBiQ0KK55
PaxDbiQ0KK55
PeptideAtlasiQ0KK55
PRIDEiQ0KK55
ProteomicsDBi297602 [Q0KK55-1]
297603 [Q0KK55-2]
297604 [Q0KK55-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
48672, 61 antibodies from 12 providers

The DNASU plasmid repository

More...
DNASUi
76484

Genome annotation databases

EnsembliENSMUST00000053445; ENSMUSP00000050586; ENSMUSG00000066129 [Q0KK55-1]
GeneIDi76484
KEGGimmu:76484
UCSCiuc009kgd.1, mouse [Q0KK55-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
85442
MGIiMGI:1923734, Kndc1
VEuPathDBiHostDB:ENSMUSG00000066129

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG502QSHW, Eukaryota
GeneTreeiENSGT00390000011408
HOGENOMiCLU_003380_0_0_1
InParanoidiQ0KK55
OMAiYWDEQLL
OrthoDBi78094at2759
PhylomeDBiQ0KK55
TreeFamiTF336009

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
76484, 0 hits in 58 CRISPR screens

Protein Ontology

More...
PROi
PR:Q0KK55
RNActiQ0KK55, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000066129, Expressed in lumbar subsegment of spinal cord and 156 other tissues
GenevisibleiQ0KK55, MM

Family and domain databases

CDDicd06224, REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR011019, KIND_dom
IPR029899, KNDC1
IPR000651, Ras-like_Gua-exchang_fac_N
IPR023578, Ras_GEF_dom_sf
IPR001895, RASGEF_cat_dom
IPR036964, RASGEF_cat_dom_sf
PANTHERiPTHR21560, PTHR21560, 1 hit
PfamiView protein in Pfam
PF16474, KIND, 1 hit
PF00617, RasGEF, 1 hit
PF00618, RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00750, KIND, 2 hits
SM00147, RasGEF, 1 hit
SUPFAMiSSF48366, SSF48366, 1 hit
SSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51377, KIND, 2 hits
PS50009, RASGEF_CAT, 1 hit
PS50212, RASGEF_NTER, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKNDC1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q0KK55
Secondary accession number(s): Q0KK50
, Q3TF27, Q3UGX9, Q3UGZ3, Q3UHK4, Q7TNH0, Q8BTH5, Q8BXJ3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: February 23, 2022
This is version 108 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again