Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 98 (13 Nov 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cytosolic carboxypeptidase-like protein 5

Gene

Agbl5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metallocarboxypeptidase that mediates protein deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins (PubMed:20519502, PubMed:21074048). In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains, a process catalyzed by AGTPBP1/CCP1, AGBL2/CCP2, AGBL3/CCP3, AGBL1/CCP4 and AGBL4/CCP6 (PubMed:25103237). Mediates deglutamylation of CGAS, regulating the antiviral activity of CGAS (PubMed:26829768).4 Publications

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi252Zinc1 Publication1
Metal bindingi255Zinc1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei303NucleophileBy similarity1
Metal bindingi434ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M14.036

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic carboxypeptidase-like protein 5 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Agbl5
Synonyms:Ccp5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2441745 Agbl5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are more vulnerable to DNA virus infection due to impaired immune response.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi252H → S: Abolishes deglutamylase activity; when associated with Q-255. 2 Publications1
Mutagenesisi255E → Q: Abolishes deglutamylase activity; when associated with S-252. 2 Publications1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003059221 – 886Cytosolic carboxypeptidase-like protein 5Add BLAST886

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei841PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q09M02

PRoteomics IDEntifications database

More...
PRIDEi
Q09M02

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q09M02

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q09M02

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highly expressed in testis, and moderately in pituitary, brain, eye and kidney.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029165 Expressed in 205 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q09M02 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q09M02 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000110348

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3641 Eukaryota
COG2866 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158032

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q09M02

KEGG Orthology (KO)

More...
KOi
K23438

Identification of Orthologs from Complete Genome Data

More...
OMAi
PETVMVI

TreeFam database of animal gene trees

More...
TreeFami
TF324301

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040626 Pepdidase_M14_N
IPR000834 Peptidase_M14

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18027 Pepdidase_M14_N, 1 hit
PF00246 Peptidase_M14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q09M02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELRCGGLLF SSRFDSGNLA HVEKVETVSS DGEGVGGVAT APASGSAASP
60 70 80 90 100
DYEFNVWTRP DCAETEYENG NRSWFYFSVR GGTPGKLIKI NIMNMNKQSK
110 120 130 140 150
LYSQGMAPFV RTLPSRPRWE RIRERPTFEM TETQFVLSFV HRFVEGRGAT
160 170 180 190 200
TFFAFCYPFS YSDCQDLLSQ LDQRFSENYS THSSPLDSIY YHRELLCYSL
210 220 230 240 250
DGLRVDLLTI TSCHGLRDDR EPRLEQLFPD LGTPRPFRFT GKRIFFLSSR
260 270 280 290 300
VHPGETPSSF VFNGFLDFIL RPDDPRAQTL RRLFVFKLIP MLNPDGVVRG
310 320 330 340 350
HYRTDSRGVN LNRQYLKPDA VLHPAIYGAK AVLLYHHVHS RLNAKSPTNQ
360 370 380 390 400
QPTLHLPPEA PLSDLEKANN LHNEAHLGQS PDGENPATWP ETEPAEEKTD
410 420 430 440 450
PVWLMPQPIP ELEEPAPDTI PPKESGVAYY VDLHGHASKR GCFMYGNSFS
460 470 480 490 500
DESTQVENML YPKLISLNSA HFDFQGCNFS EKNMYARDRR DGQSKEGSGR
510 520 530 540 550
VAIYKASGII HSYTLECNYN TGRSVNSIPA ACHDNGRASP PPPPAFPSRY
560 570 580 590 600
TVELFEQVGR AMAIAALDMA ECNPWPRIVL SEHSSLTNLR AWMLRHVRNS
610 620 630 640 650
RGLTSAGNMG ASKKRGARTP PKSNNSLPVS CSENALSRVR SFSTGTSTGG
660 670 680 690 700
SSSSQQNSPQ MKNSPSFPFH GSRTAGLPGL GSSTQKVSHR VLGPVREPRC
710 720 730 740 750
SDRRRRQQPL NHRSTTSSLA PSPTLASSGP TSSRNMGSCL LPNSLSLSGS
760 770 780 790 800
SCSFSSSGDK PEAVMVIGKS LLGAGARIPC IRTRLQARPR LGRSSPPTRR
810 820 830 840 850
GMRGSSPTSP IPQTRESSEL EPGPHSATPG LPQAGPPRPR SAPAFSPISC
860 870 880
TLSDSPSRIC YSRGLLNQCE VCFVPKSPPL TISPRV
Length:886
Mass (Da):97,607
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i58A971BD521890D6
GO
Isoform 2 (identifier: Q09M02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-886: ARPRLGRSSP...SPPLTISPRV → TCQRRVSARRGPGFPRLGPGWAGAHRRLAEG

Note: No experimental confirmation available.
Show »
Length:817
Mass (Da):90,366
Checksum:i4C090370AB629155
GO
Isoform 3 (identifier: Q09M02-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     750-886: SSCSFSSSGD...SPPLTISPRV → RYPLPLKPELPTFFPFLPPRA

Show »
Length:770
Mass (Da):85,683
Checksum:iA1EEFB1D5037750A
GO
Isoform 4 (identifier: Q09M02-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-886: ARPRLGRSSP...SPPLTISPRV → TPLSLPDAPQPQPTSFGFPTRP

Show »
Length:808
Mass (Da):89,343
Checksum:i69D1E2018E2E4536
GO
Isoform 5 (identifier: Q09M02-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: Missing.
     129-129: E → ELGSKLSPCFSKPEEAGSHVESVRGRELVK
     456-458: VEN → VGL
     459-886: Missing.

Note: No experimental confirmation available.
Show »
Length:395
Mass (Da):45,047
Checksum:iFD3426A0657D3EB8
GO
Isoform 6 (identifier: Q09M02-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     697-886: EPRCSDRRRR...SPPLTISPRV → GKPVWEPLQQVFGCLGHCWGERA

Note: No experimental confirmation available.
Show »
Length:719
Mass (Da):80,149
Checksum:i3DF13D17AC999AE7
GO
Isoform 7 (identifier: Q09M02-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: E → ELGSKLSPCFSKPEEAGSHVESVRGRELVK
     787-886: ARPRLGRSSP...SPPLTISPRV → TCQRRVSARRGPGFPRLGPGWAGAHRRLAEG

Show »
Length:846
Mass (Da):93,475
Checksum:i83CADF3960CA52E0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6TQ98F6TQ98_MOUSE
Cytosolic carboxypeptidase-like pro...
Agbl5
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YV16A0A0J9YV16_MOUSE
Cytosolic carboxypeptidase-like pro...
Agbl5
256Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YUC3A0A0J9YUC3_MOUSE
Cytosolic carboxypeptidase-like pro...
Agbl5
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YUP2A0A0J9YUP2_MOUSE
Cytosolic carboxypeptidase-like pro...
Agbl5
231Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH57349 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti103S → A in BAC29150 (PubMed:16141072).Curated1
Sequence conflicti337H → R in BAC28871 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0404271 – 92Missing in isoform 5. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_040428129E → ELGSKLSPCFSKPEEAGSHV ESVRGRELVK in isoform 5 and isoform 7. 2 Publications1
Alternative sequenceiVSP_040429456 – 458VEN → VGL in isoform 5. 1 Publication3
Alternative sequenceiVSP_040430459 – 886Missing in isoform 5. 1 PublicationAdd BLAST428
Alternative sequenceiVSP_040431697 – 886EPRCS…ISPRV → GKPVWEPLQQVFGCLGHCWG ERA in isoform 6. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_040432750 – 886SSCSF…ISPRV → RYPLPLKPELPTFFPFLPPR A in isoform 3. 2 PublicationsAdd BLAST137
Alternative sequenceiVSP_040433787 – 886ARPRL…ISPRV → TCQRRVSARRGPGFPRLGPG WAGAHRRLAEG in isoform 2 and isoform 7. 2 PublicationsAdd BLAST100
Alternative sequenceiVSP_040434787 – 886ARPRL…ISPRV → TPLSLPDAPQPQPTSFGFPT RP in isoform 4. 2 PublicationsAdd BLAST100

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ867034 mRNA Translation: ABI51953.1
DQ867035 mRNA Translation: ABI51954.1
DQ867036 mRNA Translation: ABI51955.1
DQ867037 mRNA Translation: ABI51956.1
DQ867038 mRNA Translation: ABI51957.1
AK029676 mRNA Translation: BAC26559.1
AK035680 mRNA Translation: BAC29150.1
AK034894 mRNA Translation: BAC28871.1
AK044195 mRNA Translation: BAC31813.1
AC109606 Genomic DNA No translation available.
BC057349 mRNA Translation: AAH57349.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19165.1 [Q09M02-6]
CCDS39048.1 [Q09M02-7]
CCDS80242.1 [Q09M02-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001041657.1, NM_001048192.2 [Q09M02-7]
NP_001281191.1, NM_001294262.1 [Q09M02-3]
NP_777274.1, NM_174849.3 [Q09M02-6]
XP_006503936.1, XM_006503873.3 [Q09M02-2]
XP_006503937.1, XM_006503874.3 [Q09M02-4]
XP_006503938.1, XM_006503875.1 [Q09M02-1]
XP_006503939.1, XM_006503876.1 [Q09M02-1]
XP_006503940.1, XM_006503877.1 [Q09M02-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000069705; ENSMUSP00000063228; ENSMUSG00000029165 [Q09M02-6]
ENSMUST00000114700; ENSMUSP00000110348; ENSMUSG00000029165 [Q09M02-7]
ENSMUST00000201168; ENSMUSP00000143808; ENSMUSG00000029165 [Q09M02-1]
ENSMUST00000201225; ENSMUSP00000143934; ENSMUSG00000029165 [Q09M02-3]
ENSMUST00000201817; ENSMUSP00000144304; ENSMUSG00000029165 [Q09M02-4]
ENSMUST00000201917; ENSMUSP00000144188; ENSMUSG00000029165 [Q09M02-2]
ENSMUST00000202060; ENSMUSP00000144018; ENSMUSG00000029165 [Q09M02-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
231093

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:231093

UCSC genome browser

More...
UCSCi
uc008wwc.1 mouse [Q09M02-6]
uc008wwd.1 mouse [Q09M02-5]
uc008wwf.2 mouse [Q09M02-3]
uc008wwg.2 mouse [Q09M02-7]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867034 mRNA Translation: ABI51953.1
DQ867035 mRNA Translation: ABI51954.1
DQ867036 mRNA Translation: ABI51955.1
DQ867037 mRNA Translation: ABI51956.1
DQ867038 mRNA Translation: ABI51957.1
AK029676 mRNA Translation: BAC26559.1
AK035680 mRNA Translation: BAC29150.1
AK034894 mRNA Translation: BAC28871.1
AK044195 mRNA Translation: BAC31813.1
AC109606 Genomic DNA No translation available.
BC057349 mRNA Translation: AAH57349.1 Different initiation.
CCDSiCCDS19165.1 [Q09M02-6]
CCDS39048.1 [Q09M02-7]
CCDS80242.1 [Q09M02-3]
RefSeqiNP_001041657.1, NM_001048192.2 [Q09M02-7]
NP_001281191.1, NM_001294262.1 [Q09M02-3]
NP_777274.1, NM_174849.3 [Q09M02-6]
XP_006503936.1, XM_006503873.3 [Q09M02-2]
XP_006503937.1, XM_006503874.3 [Q09M02-4]
XP_006503938.1, XM_006503875.1 [Q09M02-1]
XP_006503939.1, XM_006503876.1 [Q09M02-1]
XP_006503940.1, XM_006503877.1 [Q09M02-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110348

Protein family/group databases

MEROPSiM14.036

PTM databases

iPTMnetiQ09M02
PhosphoSitePlusiQ09M02

Proteomic databases

PaxDbiQ09M02
PRIDEiQ09M02

Genome annotation databases

EnsembliENSMUST00000069705; ENSMUSP00000063228; ENSMUSG00000029165 [Q09M02-6]
ENSMUST00000114700; ENSMUSP00000110348; ENSMUSG00000029165 [Q09M02-7]
ENSMUST00000201168; ENSMUSP00000143808; ENSMUSG00000029165 [Q09M02-1]
ENSMUST00000201225; ENSMUSP00000143934; ENSMUSG00000029165 [Q09M02-3]
ENSMUST00000201817; ENSMUSP00000144304; ENSMUSG00000029165 [Q09M02-4]
ENSMUST00000201917; ENSMUSP00000144188; ENSMUSG00000029165 [Q09M02-2]
ENSMUST00000202060; ENSMUSP00000144018; ENSMUSG00000029165 [Q09M02-3]
GeneIDi231093
KEGGimmu:231093
UCSCiuc008wwc.1 mouse [Q09M02-6]
uc008wwd.1 mouse [Q09M02-5]
uc008wwf.2 mouse [Q09M02-3]
uc008wwg.2 mouse [Q09M02-7]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
60509
MGIiMGI:2441745 Agbl5

Phylogenomic databases

eggNOGiKOG3641 Eukaryota
COG2866 LUCA
GeneTreeiENSGT00940000158032
InParanoidiQ09M02
KOiK23438
OMAiPETVMVI
TreeFamiTF324301

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Agbl5 mouse

Protein Ontology

More...
PROi
PR:Q09M02

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029165 Expressed in 205 organ(s), highest expression level in testis
ExpressionAtlasiQ09M02 baseline and differential
GenevisibleiQ09M02 MM

Family and domain databases

InterProiView protein in InterPro
IPR040626 Pepdidase_M14_N
IPR000834 Peptidase_M14
PfamiView protein in Pfam
PF18027 Pepdidase_M14_N, 1 hit
PF00246 Peptidase_M14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCBPC5_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q09M02
Secondary accession number(s): D3Z6S8
, Q09M01, Q09M03, Q09M04, Q6PFZ3, Q8BLL9, Q8BM52, Q8BZD8, Q8C0W4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: January 11, 2011
Last modified: November 13, 2019
This is version 98 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again