Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (02 Dec 2020)
Sequence version 2 (15 May 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 415

Gene

ZNF415

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in transcriptional regulation. Transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppresses the transcriptional activities of AP-1 and p53/TP53.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri264 – 286C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri348 – 370C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri376 – 398C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri404 – 426C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri460 – 482C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri488 – 510C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri516 – 538C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri544 – 566C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri572 – 594C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q09FC8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436, Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 415
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF415
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...
EuPathDBi
HostDB:ENSG00000170954.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20636, ZNF415

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q09FC8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55786

Open Targets

More...
OpenTargetsi
ENSG00000170954

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134984602

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q09FC8, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF415

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147742905

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002868081 – 603Zinc finger protein 415Add BLAST603

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q09FC8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q09FC8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q09FC8

PeptideAtlas

More...
PeptideAtlasi
Q09FC8

PRoteomics IDEntifications database

More...
PRIDEi
Q09FC8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25895
58725 [Q09FC8-1]
58726 [Q09FC8-2]
58727 [Q09FC8-3]
58728 [Q09FC8-4]
58729 [Q09FC8-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q09FC8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q09FC8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues examined. Isoforms are differentially expressed. Isoform 3 and isoform 5 were highly expressed, isoform 4 moderately expressed, isoform 2 lower expression, the lowest expression level was seem with isoform 1.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170954, Expressed in sperm and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q09FC8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q09FC8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000170954, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120900, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q09FC8, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000439435

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q09FC8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q09FC8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri348 – 370C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri376 – 398C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri404 – 426C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri460 – 482C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri488 – 510C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri516 – 538C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri544 – 566C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri572 – 594C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164638

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002678_44_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q09FC8

Identification of Orthologs from Complete Genome Data

More...
OMAi
ESHPIGD

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q09FC8

TreeFam database of animal gene trees

More...
TreeFami
TF341892

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096, zf-C2H2, 11 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355, ZnF_C2H2, 11 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667, SSF57667, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 11 hits
PS50157, ZINC_FINGER_C2H2_2, 11 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q09FC8-1) [UniParc]FASTAAdd to basket
Also known as: ZNF415-3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPELYTEDFI QGCDVGELQE PGLPGVLSYV GAQERALDHR KPSTSSKKTK
60 70 80 90 100
RVEIDQRCEN RLECNGAISA HCNLRLPDSN DSPASASRVA GITDLSRNCV
110 120 130 140 150
IKELAPQQEG NPGEVFHTVT LEQHEKHDIE EFCFREIKKK IHDFDCQWRD
160 170 180 190 200
DERNCNKVTT APKENLTCRR DQRDRRGIGN KSIKHQLGLS FLPHPHELQQ
210 220 230 240 250
FQAEGKIYEC NHVEKSVNHG SSVSPPQIIS STIKTHVSNK YGTDFICSSL
260 270 280 290 300
LTQEQKSCIR EKPYRYIECD KALNHGSHMT VRQVSHSGEK GYKCDLCGKV
310 320 330 340 350
FSQKSNLARH WRVHTGEKPY KCNECDRSFS RNSCLALHRR VHTGEKPYKC
360 370 380 390 400
YECDKVFSRN SCLALHQKTH IGEKPYTCKE CGKAFSVRST LTNHQVIHSG
410 420 430 440 450
KKPYKCNECG KVFSQTSSLA THQRIHTGEK PYKCNECGKV FSQTSSLARH
460 470 480 490 500
WRIHTGEKPY KCNECGKVFS YNSHLASHRR VHTGEKPYKC NECGKAFSVH
510 520 530 540 550
SNLTTHQVIH TGEKPYKCNQ CGKGFSVHSS LTTHQVIHTG EKPYKCNECG
560 570 580 590 600
KSFSVRPNLT RHQIIHTGKK PYKCSDCGKS FSVRPNLFRH QIIHTKEKPY

KRN
Length:603
Mass (Da):68,798
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6B62D29A4E6E9300
GO
Isoform 2 (identifier: Q09FC8-2) [UniParc]FASTAAdd to basket
Also known as: ZNF415-2

The sequence of this isoform differs from the canonical sequence as follows:
     26-61: Missing.

Show »
Length:567
Mass (Da):64,629
Checksum:iF3858FF0048D2953
GO
Isoform 3 (identifier: Q09FC8-3) [UniParc]FASTAAdd to basket
Also known as: ZNF415-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-278: Missing.

Show »
Length:325
Mass (Da):37,237
Checksum:i8E557F03DB31B1BE
GO
Isoform 4 (identifier: Q09FC8-4) [UniParc]FASTAAdd to basket
Also known as: ZNF415-4

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MPELYTEDFI...PASASRVAGI → MWEHRKEPWTIESQVRVARKPKGWEWIKGVK

Show »
Length:542
Mass (Da):62,646
Checksum:i7EFB14E7808AE46B
GO
Isoform 5 (identifier: Q09FC8-5) [UniParc]FASTAAdd to basket
Also known as: ZNF415-5

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: MPELYTEDFI...ASASRVAGIT → MAFTQLTFRD...LENYRNLVSL

Show »
Length:555
Mass (Da):64,116
Checksum:i6BF6BA5514484EC4
GO
Isoform 6 (identifier: Q09FC8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: MPELYTEDFI...ASASRVAGIT → MDGDGLTFRD...LENYRNLVSL

Show »
Length:555
Mass (Da):64,012
Checksum:i41AFE1DB5E2F6AD0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R2T6M0R2T6_HUMAN
Zinc finger protein 415
ZNF415
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R191M0R191_HUMAN
Zinc finger protein 415
ZNF415
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXZ4M0QXZ4_HUMAN
Zinc finger protein 415
ZNF415
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0D9M0R0D9_HUMAN
Zinc finger protein 415
ZNF415
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZA6M0QZA6_HUMAN
Zinc finger protein 415
ZNF415
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0R1M0R0R1_HUMAN
Zinc finger protein 415
ZNF415
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2I1M0R2I1_HUMAN
Zinc finger protein 415
ZNF415
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QX59M0QX59_HUMAN
Zinc finger protein 415
ZNF415
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZ38M0QZ38_HUMAN
Zinc finger protein 415
ZNF415
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1N1M0R1N1_HUMAN
Zinc finger protein 415
ZNF415
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032166196H → P. Corresponds to variant dbSNP:rs16984466Ensembl.1
Natural variantiVAR_032167229I → L2 PublicationsCorresponds to variant dbSNP:rs1054485Ensembl.1
Natural variantiVAR_032168233I → V2 PublicationsCorresponds to variant dbSNP:rs1133327Ensembl.1
Natural variantiVAR_032169241Y → C. Corresponds to variant dbSNP:rs1560099Ensembl.1
Natural variantiVAR_032170463N → D1 PublicationCorresponds to variant dbSNP:rs10410030Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0251751 – 278Missing in isoform 3. 1 PublicationAdd BLAST278
Alternative sequenceiVSP_0251761 – 93MPELY…VAGIT → MAFTQLTFRDVAIEFSQDEW KCLNSTQRTLYRDVMLENYR NLVSL in isoform 5. 2 PublicationsAdd BLAST93
Alternative sequenceiVSP_0448071 – 93MPELY…VAGIT → MDGDGLTFRDVAIEFSQDEW KCLNSTQRTLYRDVMLENYR NLVSL in isoform 6. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0251771 – 92MPELY…RVAGI → MWEHRKEPWTIESQVRVARK PKGWEWIKGVK in isoform 4. 2 PublicationsAdd BLAST92
Alternative sequenceiVSP_02517826 – 61Missing in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ925697 mRNA Translation: ABI51311.1
DQ925696 mRNA Translation: ABI51310.1
DQ925698 mRNA Translation: ABI51312.1
DQ925695 mRNA Translation: ABI51309.1
AY283600 mRNA Translation: AAP35086.1
AK002053 mRNA Translation: BAA92059.1
DA518713 mRNA No translation available.
AC010328 Genomic DNA No translation available.
BC069668 mRNA Translation: AAH69668.1
BC063880 mRNA Translation: AAH63880.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12860.1 [Q09FC8-5]
CCDS54313.1 [Q09FC8-6]
CCDS82393.1 [Q09FC8-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001129510.2, NM_001136038.2 [Q09FC8-6]
NP_001157781.1, NM_001164309.1 [Q09FC8-5]
NP_001317688.1, NM_001330759.1 [Q09FC8-3]
NP_001317695.1, NM_001330766.1
NP_060825.2, NM_018355.3 [Q09FC8-5]
XP_006723335.1, XM_006723272.2
XP_006723336.1, XM_006723273.2
XP_006723337.1, XM_006723274.2
XP_006723340.1, XM_006723277.2
XP_006723342.1, XM_006723279.1 [Q09FC8-4]
XP_006723343.1, XM_006723280.2 [Q09FC8-3]
XP_006723344.1, XM_006723281.2
XP_011525405.1, XM_011527103.1
XP_011525406.1, XM_011527104.1
XP_016882453.1, XM_017026964.1 [Q09FC8-5]
XP_016882454.1, XM_017026965.1
XP_016882455.1, XM_017026966.1
XP_016882456.1, XM_017026967.1
XP_016882457.1, XM_017026968.1 [Q09FC8-4]
XP_016882459.1, XM_017026970.1 [Q09FC8-2]
XP_016882461.1, XM_017026972.1
XP_016882462.1, XM_017026973.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000243643; ENSP00000243643; ENSG00000170954 [Q09FC8-5]
ENST00000421033; ENSP00000395055; ENSG00000170954 [Q09FC8-5]
ENST00000500065; ENSP00000439435; ENSG00000170954 [Q09FC8-6]
ENST00000601493; ENSP00000472911; ENSG00000170954 [Q09FC8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55786

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55786

UCSC genome browser

More...
UCSCi
uc002qaw.4, human [Q09FC8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ925697 mRNA Translation: ABI51311.1
DQ925696 mRNA Translation: ABI51310.1
DQ925698 mRNA Translation: ABI51312.1
DQ925695 mRNA Translation: ABI51309.1
AY283600 mRNA Translation: AAP35086.1
AK002053 mRNA Translation: BAA92059.1
DA518713 mRNA No translation available.
AC010328 Genomic DNA No translation available.
BC069668 mRNA Translation: AAH69668.1
BC063880 mRNA Translation: AAH63880.1
CCDSiCCDS12860.1 [Q09FC8-5]
CCDS54313.1 [Q09FC8-6]
CCDS82393.1 [Q09FC8-3]
RefSeqiNP_001129510.2, NM_001136038.2 [Q09FC8-6]
NP_001157781.1, NM_001164309.1 [Q09FC8-5]
NP_001317688.1, NM_001330759.1 [Q09FC8-3]
NP_001317695.1, NM_001330766.1
NP_060825.2, NM_018355.3 [Q09FC8-5]
XP_006723335.1, XM_006723272.2
XP_006723336.1, XM_006723273.2
XP_006723337.1, XM_006723274.2
XP_006723340.1, XM_006723277.2
XP_006723342.1, XM_006723279.1 [Q09FC8-4]
XP_006723343.1, XM_006723280.2 [Q09FC8-3]
XP_006723344.1, XM_006723281.2
XP_011525405.1, XM_011527103.1
XP_011525406.1, XM_011527104.1
XP_016882453.1, XM_017026964.1 [Q09FC8-5]
XP_016882454.1, XM_017026965.1
XP_016882455.1, XM_017026966.1
XP_016882456.1, XM_017026967.1
XP_016882457.1, XM_017026968.1 [Q09FC8-4]
XP_016882459.1, XM_017026970.1 [Q09FC8-2]
XP_016882461.1, XM_017026972.1
XP_016882462.1, XM_017026973.1

3D structure databases

SMRiQ09FC8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120900, 4 interactors
IntActiQ09FC8, 3 interactors
STRINGi9606.ENSP00000439435

PTM databases

iPTMnetiQ09FC8
PhosphoSitePlusiQ09FC8

Polymorphism and mutation databases

BioMutaiZNF415
DMDMi147742905

Proteomic databases

jPOSTiQ09FC8
MassIVEiQ09FC8
PaxDbiQ09FC8
PeptideAtlasiQ09FC8
PRIDEiQ09FC8
ProteomicsDBi25895
58725 [Q09FC8-1]
58726 [Q09FC8-2]
58727 [Q09FC8-3]
58728 [Q09FC8-4]
58729 [Q09FC8-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
820, 138 antibodies

The DNASU plasmid repository

More...
DNASUi
55786

Genome annotation databases

EnsembliENST00000243643; ENSP00000243643; ENSG00000170954 [Q09FC8-5]
ENST00000421033; ENSP00000395055; ENSG00000170954 [Q09FC8-5]
ENST00000500065; ENSP00000439435; ENSG00000170954 [Q09FC8-6]
ENST00000601493; ENSP00000472911; ENSG00000170954 [Q09FC8-3]
GeneIDi55786
KEGGihsa:55786
UCSCiuc002qaw.4, human [Q09FC8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55786
DisGeNETi55786
EuPathDBiHostDB:ENSG00000170954.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF415
HGNCiHGNC:20636, ZNF415
HPAiENSG00000170954, Low tissue specificity
neXtProtiNX_Q09FC8
OpenTargetsiENSG00000170954
PharmGKBiPA134984602

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000164638
HOGENOMiCLU_002678_44_0_1
InParanoidiQ09FC8
OMAiESHPIGD
OrthoDBi1318335at2759
PhylomeDBiQ09FC8
TreeFamiTF341892

Enzyme and pathway databases

PathwayCommonsiQ09FC8
ReactomeiR-HSA-212436, Generic Transcription Pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55786, 6 hits in 867 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF415, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55786
PharosiQ09FC8, Tdark

Protein Ontology

More...
PROi
PR:Q09FC8
RNActiQ09FC8, protein

Gene expression databases

BgeeiENSG00000170954, Expressed in sperm and 212 other tissues
ExpressionAtlasiQ09FC8, baseline and differential
GenevisibleiQ09FC8, HS

Family and domain databases

InterProiView protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00096, zf-C2H2, 11 hits
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 11 hits
SUPFAMiSSF57667, SSF57667, 6 hits
PROSITEiView protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 11 hits
PS50157, ZINC_FINGER_C2H2_2, 11 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN415_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q09FC8
Secondary accession number(s): F5H287
, Q09FC7, Q09FC9, Q09FD0, Q6NSZ2, Q6P3S0, Q9NUR2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: December 2, 2020
This is version 132 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again