Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuroblast differentiation-associated protein AHNAK

Gene

AHNAK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be required for neuronal cell differentiation.

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • RNA binding Source: UniProtKB
  • S100 protein binding Source: UniProtKB
  • structural molecule activity conferring elasticity Source: UniProtKB

GO - Biological processi

  • protein complex oligomerization Source: UniProtKB
  • regulation of RNA splicing Source: UniProtKB
  • regulation of voltage-gated calcium channel activity Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
Neuroblast differentiation-associated protein AHNAK
Alternative name(s):
Desmoyokin
Gene namesi
Name:AHNAK
Synonyms:PM227
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000124942.13
HGNCiHGNC:347 AHNAK
MIMi103390 gene
neXtProtiNX_Q09666

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi79026
OpenTargetsiENSG00000124942
PharmGKBiPA24640

Polymorphism and mutation databases

DMDMi160332335

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000645041 – 5890Neuroblast differentiation-associated protein AHNAKAdd BLAST5890

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei41PhosphoserineCombined sources1
Modified residuei93PhosphoserineCombined sources1
Modified residuei101PhosphothreonineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Cross-linki134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei135PhosphoserineCombined sources1
Modified residuei158PhosphothreonineCombined sources1
Modified residuei177PhosphoserineCombined sources1
Cross-linki181Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei210PhosphoserineCombined sources1
Modified residuei212PhosphoserineCombined sources1
Modified residuei216PhosphoserineCombined sources1
Modified residuei218PhosphothreonineCombined sources1
Modified residuei220PhosphoserineCombined sources1
Modified residuei256PhosphoserineCombined sources1
Modified residuei270Omega-N-methylarginineCombined sources1
Modified residuei332PhosphoserineCombined sources1
Modified residuei337PhosphoserineCombined sources1
Modified residuei379PhosphoserineCombined sources1
Modified residuei470PhosphoserineCombined sources1
Modified residuei490PhosphothreonineCombined sources1
Modified residuei511PhosphoserineCombined sources1
Modified residuei551PhosphothreonineCombined sources1
Modified residuei553PhosphothreonineCombined sources1
Modified residuei559PhosphoserineCombined sources1
Modified residuei570PhosphoserineCombined sources1
Modified residuei572PhosphoserineCombined sources1
Modified residuei658PhosphoserineCombined sources1
Cross-linki712Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki763Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei793PhosphoserineCombined sources1
Modified residuei819PhosphoserineCombined sources1
Cross-linki891Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki942Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki961Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki961Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei1010PhosphoserineCombined sources1
Modified residuei1042PhosphoserineCombined sources1
Modified residuei1068PhosphoserineCombined sources1
Modified residuei1170PhosphoserineCombined sources1
Modified residuei1192PhosphothreonineCombined sources1
Modified residuei1196PhosphoserineCombined sources1
Modified residuei1208N6-methyllysineCombined sources1
Modified residuei1286PhosphoserineCombined sources1
Modified residuei1298PhosphoserineCombined sources1
Modified residuei1580PhosphoserineCombined sources1
Modified residuei1654PhosphoserineCombined sources1
Modified residuei1666N6-methyllysineCombined sources1
Cross-linki1726Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1856PhosphoserineCombined sources1
Modified residuei1868N6-methyllysineCombined sources1
Modified residuei1923PhosphoserineCombined sources1
Modified residuei1935N6-methyllysineCombined sources1
Modified residuei1986PhosphothreonineCombined sources1
Modified residuei1990PhosphoserineCombined sources1
Modified residuei2002N6-methyllysineCombined sources1
Cross-linki2062Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei2092PhosphoserineCombined sources1
Modified residuei2118PhosphoserineCombined sources1
Modified residuei2130N6-methyllysineCombined sources1
Cross-linki2132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei2138PhosphoserineCombined sources1
Modified residuei2181PhosphothreonineCombined sources1
Modified residuei2287PhosphoserineCombined sources1
Modified residuei2309PhosphothreonineCombined sources1
Modified residuei2397PhosphoserineCombined sources1
Cross-linki2524Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2575Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei2580PhosphoserineCombined sources1
Cross-linki2594Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei2600PhosphoserineCombined sources1
Modified residuei2670PhosphoserineCombined sources1
Cross-linki2703Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei2708PhosphoserineCombined sources1
Cross-linki2722Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei2728PhosphoserineCombined sources1
Modified residuei2798PhosphoserineCombined sources1
Modified residuei2832PhosphothreonineCombined sources1
Modified residuei2845PhosphothreonineCombined sources1
Cross-linki2908Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2959Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei3054PhosphoserineCombined sources1
Cross-linki3087Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei3092PhosphoserineCombined sources1
Modified residuei3182PhosphoserineCombined sources1
Cross-linki3215Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei3220PhosphoserineCombined sources1
Modified residuei3362PhosphoserineCombined sources1
Modified residuei3409PhosphoserineCombined sources1
Modified residuei3412PhosphoserineCombined sources1
Modified residuei3426PhosphoserineCombined sources1
Modified residuei3544PhosphoserineCombined sources1
Cross-linki3667Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei3716PhosphothreonineCombined sources1
Modified residuei3746PhosphoserineCombined sources1
Cross-linki3760Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei3766PhosphoserineCombined sources1
Modified residuei3836PhosphoserineCombined sources1
Cross-linki3869Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei3874PhosphoserineCombined sources1
Modified residuei3964PhosphoserineCombined sources1
Cross-linki3997Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4002PhosphoserineCombined sources1
Cross-linki4016Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4022PhosphoserineCombined sources1
Modified residuei4092PhosphoserineCombined sources1
Modified residuei4100PhosphothreonineCombined sources1
Modified residuei4150PhosphoserineCombined sources1
Modified residuei4220PhosphoserineCombined sources1
Cross-linki4253Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4258PhosphoserineCombined sources1
Cross-linki4272Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4278PhosphoserineCombined sources1
Modified residuei4360PhosphoserineCombined sources1
Cross-linki4381Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki4400Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4406PhosphoserineCombined sources1
Modified residuei4425PhosphoserineCombined sources1
Modified residuei4430PhosphothreonineCombined sources1
Cross-linki4455Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4460PhosphoserineCombined sources1
Cross-linki4474Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei4480PhosphoserineCombined sources1
Modified residuei4486PhosphoserineCombined sources1
Modified residuei4516PhosphoserineCombined sources1
Modified residuei4520PhosphoserineCombined sources1
Modified residuei4564PhosphothreonineCombined sources1
Modified residuei4684PhosphoserineCombined sources1
Modified residuei4722PhosphoserineCombined sources1
Modified residuei4766PhosphothreonineCombined sources1
Modified residuei4812PhosphoserineCombined sources1
Modified residuei4900PhosphoserineCombined sources1
Modified residuei4903PhosphoserineCombined sources1
Modified residuei4908PhosphoserineCombined sources1
Modified residuei4953PhosphoserineCombined sources1
Modified residuei4960PhosphoserineCombined sources1
Modified residuei4986PhosphoserineCombined sources1
Modified residuei4993PhosphoserineCombined sources1
Modified residuei5009PhosphothreonineCombined sources1
Modified residuei5077PhosphoserineCombined sources1
Modified residuei5099PhosphoserineCombined sources1
Modified residuei5110PhosphoserineCombined sources1
Modified residuei5125PhosphoserineCombined sources1
Modified residuei5261PhosphoserineCombined sources1
Modified residuei5318PhosphoserineCombined sources1
Modified residuei5332PhosphoserineCombined sources1
Modified residuei5369PhosphoserineCombined sources1
Modified residuei5386PhosphoserineCombined sources1
Modified residuei5393PhosphoserineCombined sources1
Modified residuei5400PhosphoserineCombined sources1
Modified residuei5415PhosphothreonineCombined sources1
Modified residuei5448PhosphoserineCombined sources1
Modified residuei5519PhosphoserineCombined sources1
Modified residuei5530PhosphoserineCombined sources1
Modified residuei5552PhosphoserineCombined sources1
Modified residuei5577PhosphoserineCombined sources1
Modified residuei5620PhosphoserineCombined sources1
Cross-linki5623Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei5641PhosphoserineCombined sources1
Modified residuei5731PhosphoserineCombined sources1
Modified residuei5739PhosphoserineCombined sources1
Modified residuei5749PhosphoserineCombined sources1
Modified residuei5752PhosphoserineCombined sources1
Modified residuei5762PhosphoserineCombined sources1
Modified residuei5763PhosphoserineCombined sources1
Modified residuei5780PhosphoserineCombined sources1
Modified residuei5782PhosphoserineCombined sources1
Modified residuei5790PhosphoserineCombined sources1
Modified residuei5793PhosphoserineCombined sources1
Modified residuei5794PhosphothreonineCombined sources1
Modified residuei5824PhosphothreonineCombined sources1
Modified residuei5830PhosphoserineCombined sources1
Modified residuei5841PhosphoserineCombined sources1
Modified residuei5845PhosphothreonineCombined sources1
Modified residuei5851PhosphoserineCombined sources1
Modified residuei5857PhosphoserineCombined sources1
Modified residuei5863PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ09666
MaxQBiQ09666
PaxDbiQ09666
PeptideAtlasiQ09666
PRIDEiQ09666
ProteomicsDBi58724

PTM databases

CarbonylDBiQ09666
iPTMnetiQ09666
PhosphoSitePlusiQ09666
SwissPalmiQ09666

Expressioni

Gene expression databases

BgeeiENSG00000124942 Expressed in 244 organ(s), highest expression level in olfactory bulb
CleanExiHS_AHNAK
ExpressionAtlasiQ09666 baseline and differential
GenevisibleiQ09666 HS

Organism-specific databases

HPAiHPA019010
HPA019070
HPA026643

Interactioni

Subunit structurei

Interacts with DYSF; the interaction is direct and Ca2+-independent.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122494, 117 interactors
ComplexPortaliCPX-850 AHNAK - Annexin A2 - S100-A10 complex
CORUMiQ09666
IntActiQ09666, 45 interactors
MINTiQ09666
STRINGi9606.ENSP00000367263

Structurei

3D structure databases

ProteinModelPortaliQ09666
SMRiQ09666
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 90PDZPROSITE-ProRule annotationAdd BLAST82

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi4971 – 4979Nuclear localization signalSequence analysis9
Motifi5019 – 5027Nuclear localization signalSequence analysis9
Motifi5034 – 5039Nuclear localization signalSequence analysis6
Motifi5706 – 5716Nuclear localization signalSequence analysisAdd BLAST11
Motifi5772 – 5779Nuclear localization signalSequence analysis8

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5458 – 5654Gly-richAdd BLAST197

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410JR2V Eukaryota
ENOG410ZVP4 LUCA
GeneTreeiENSGT00530000063716
HOGENOMiHOG000033865
HOVERGENiHBG070979
InParanoidiQ09666
OMAiINAPHGK
OrthoDBiEOG091G01FG
PhylomeDBiQ09666
TreeFamiTF350595

Family and domain databases

InterProiView protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q09666-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKEETTREL LLPNWQGSGS HGLTIAQRDD GVFVQEVTQN SPAARTGVVK
60 70 80 90 100
EGDQIVGATI YFDNLQSGEV TQLLNTMGHH TVGLKLHRKG DRSPEPGQTW
110 120 130 140 150
TREVFSSCSS EVVLSGDDEE YQRIYTTKIK PRLKSEDGVE GDLGETQSRT
160 170 180 190 200
ITVTRRVTAY TVDVTGREGA KDIDISSPEF KIKIPRHELT EISNVDVETQ
210 220 230 240 250
SGKTVIRLPS GSGAASPTGS AVDIRAGAIS ASGPELQGAG HSKLQVTMPG
260 270 280 290 300
IKVGGSGVNV NAKGLDLGGR GGVQVPAVDI SSSLGGRAVE VQGPSLESGD
310 320 330 340 350
HGKIKFPTMK VPKFGVSTGR EGQTPKAGLR VSAPEVSVGH KGGKPGLTIQ
360 370 380 390 400
APQLEVSVPS ANIEGLEGKL KGPQITGPSL EGDLGLKGAK PQGHIGVDAS
410 420 430 440 450
APQIGGSITG PSVEVQAPDI DVQGPGSKLN VPKMKVPKFS VSGAKGEETG
460 470 480 490 500
IDVTLPTGEV TVPGVSGDVS LPEIATGGLE GKMKGTKVKT PEMIIQKPKI
510 520 530 540 550
SMQDVDLSLG SPKLKGDIKV SAPGVQGDVK GPQVALKGSR VDIETPNLEG
560 570 580 590 600
TLTGPRLGSP SGKTGTCRIS MSEVDLNVAA PKVKGGVDVT LPRVEGKVKV
610 620 630 640 650
PEVDVRGPKV DVSAPDVEAH GPEWNLKMPK MKMPTFSTPG AKGEGPDVHM
660 670 680 690 700
TLPKGDISIS GPKVNVEAPD VNLEGLGGKL KGPDVKLPDM SVKTPKISMP
710 720 730 740 750
DVDLHVKGTK VKGEYDVTVP KLEGELKGPK VDIDAPDVDV HGPDWHLKMP
760 770 780 790 800
KMKMPKFSVP GFKAEGPEVD VNLPKADVDI SGPKIDVTAP DVSIEEPEGK
810 820 830 840 850
LKGPKFKMPE MNIKVPKISM PDVDLHLKGP NVKGEYDVTM PKVESEIKVP
860 870 880 890 900
DVELKSAKMD IDVPDVEVQG PDWHLKMPKM KMPKFSMPGF KAEGPEVDVN
910 920 930 940 950
LPKADVDISG PKVGVEVPDV NIEGPEGKLK GPKFKMPEMN IKAPKISMPD
960 970 980 990 1000
VDLHMKGPKV KGEYDMTVPK LEGDLKGPKV DVSAPDVEMQ GPDWNLKMPK
1010 1020 1030 1040 1050
IKMPKFSMPS LKGEGPEFDV NLSKANVDIS APKVDTNAPD LSLEGPEGKL
1060 1070 1080 1090 1100
KGPKFKMPEM HFRAPKMSLP DVDLDLKGPK MKGNVDISAP KIEGEMQVPD
1110 1120 1130 1140 1150
VDIRGPKVDI KAPDVEGQGL DWSLKIPKMK MPKFSMPSLK GEGPEVDVNL
1160 1170 1180 1190 1200
PKADVVVSGP KVDIEAPDVS LEGPEGKLKG PKFKMPEMHF KTPKISMPDV
1210 1220 1230 1240 1250
DLHLKGPKVK GDVDVSVPKV EGEMKVPDVE IKGPKMDIDA PDVEVQGPDW
1260 1270 1280 1290 1300
HLKMPKMKMP KFSMPGFKGE GREVDVNLPK ADIDVSGPKV DVEVPDVSLE
1310 1320 1330 1340 1350
GPEGKLKGPK FKMPEMHFKA PKISMPDVDL NLKGPKLKGD VDVSLPEVEG
1360 1370 1380 1390 1400
EMKVPDVDIK GPKVDISAPD VDVHGPDWHL KMPKVKMPKF SMPGFKGEGP
1410 1420 1430 1440 1450
EVDVKLPKAD VDVSGPKMDA EVPDVNIEGP DAKLKGPKFK MPEMSIKPQK
1460 1470 1480 1490 1500
ISIPDVGLHL KGPKMKGDYD VTVPKVEGEI KAPDVDIKGP KVDINAPDVE
1510 1520 1530 1540 1550
VHGPDWHLKM PKVKMPKFSM PGFKGEGPEV DMNLPKADLG VSGPKVDIDV
1560 1570 1580 1590 1600
PDVNLEAPEG KLKGPKFKMP SMNIQTHKIS MPDVGLNLKA PKLKTDVDVS
1610 1620 1630 1640 1650
LPKVEGDLKG PEIDVKAPKM DVNVGDIDIE GPEGKLKGPK FKMPEMHFKA
1660 1670 1680 1690 1700
PKISMPDVDL HLKGPKVKGD MDVSVPKVEG EMKVPDVDIK GPKVDIDAPD
1710 1720 1730 1740 1750
VEVHDPDWHL KMPKMKMPKF SMPGFKAEGP EVDVNLPKAD IDVSGPSVDT
1760 1770 1780 1790 1800
DAPDLDIEGP EGKLKGSKFK MPKLNIKAPK VSMPDVDLNL KGPKLKGEID
1810 1820 1830 1840 1850
ASVPELEGDL RGPQVDVKGP FVEAEVPDVD LECPDAKLKG PKFKMPEMHF
1860 1870 1880 1890 1900
KAPKISMPDV DLHLKGPKVK GDADVSVPKL EGDLTGPSVG VEVPDVELEC
1910 1920 1930 1940 1950
PDAKLKGPKF KMPDMHFKAP KISMPDVDLH LKGPKVKGDV DVSVPKLEGD
1960 1970 1980 1990 2000
LTGPSVGVEV PDVELECPDA KLKGPKFKMP EMHFKTPKIS MPDVDLHLKG
2010 2020 2030 2040 2050
PKVKGDMDVS VPKVEGEMKV PDVDIKGPKM DIDAPDVDVH GPDWHLKMPK
2060 2070 2080 2090 2100
MKMPKFSMPG FKAEGPEVDV NLPKADVVVS GPKVDVEVPD VSLEGPEGKL
2110 2120 2130 2140 2150
KGPKLKMPEM HFKAPKISMP DVDLHLKGPK VKGDVDVSLP KLEGDLTGPS
2160 2170 2180 2190 2200
VDVEVPDVEL ECPDAKLKGP KFKMPEMHFK TPKISMPDVN LNLKGPKVKG
2210 2220 2230 2240 2250
DMDVSVPKVE GEMKVPDVDI RGPKVDIDAP DVDVHGPDWH LKMPKMKMPK
2260 2270 2280 2290 2300
FSMPGFKGEG PEVDVNLPKA DVDVSGPKVD VEVPDVSLEG PEGKLKGPKF
2310 2320 2330 2340 2350
KMPEMHFKTP KISMPDVDFN LKGPKIKGDV DVSAPKLEGE LKGPELDVKG
2360 2370 2380 2390 2400
PKLDADMPEV AVEGPNGKWK TPKFKMPDMH FKAPKISMPD LDLHLKSPKA
2410 2420 2430 2440 2450
KGEVDVDVPK LEGDLKGPHV DVSGPDIDIE GPEGKLKGPK FKMPDMHFKA
2460 2470 2480 2490 2500
PNISMPDVDL NLKGPKIKGD VDVSVPEVEG KLEVPDMNIR GPKVDVNAPD
2510 2520 2530 2540 2550
VQAPDWHLKM PKMKMPKFSM PGFKAEGPEV DVNLPKADVD ISGPKVDIEG
2560 2570 2580 2590 2600
PDVNIEGPEG KLKGPKLKMP EMNIKAPKIS MPDFDLHLKG PKVKGDVDVS
2610 2620 2630 2640 2650
LPKVEGDLKG PEVDIKGPKV DINAPDVGVQ GPDWHLKMPK VKMPKFSMPG
2660 2670 2680 2690 2700
FKGEGPDGDV KLPKADIDVS GPKVDIEGPD VNIEGPEGKL KGPKFKMPEM
2710 2720 2730 2740 2750
NIKAPKISMP DIDLNLKGPK VKGDVDVSLP KVEGDLKGPE VDIKGPKVDI
2760 2770 2780 2790 2800
DAPDVDVHGP DWHLKMPKIK MPKISMPGFK GEGPDVDVNL PKADIDVSGP
2810 2820 2830 2840 2850
KVDVECPDVN IEGPEGKWKS PKFKMPEMHF KTPKISMPDI DLNLTGPKIK
2860 2870 2880 2890 2900
GDVDVTGPKV EGDLKGPEVD LKGPKVDIDV PDVNVQGPDW HLKMPKMKMP
2910 2920 2930 2940 2950
KFSMPGFKAE GPEVDVNLPK ADVDVSGPKV DVEGPDVNIE GPEGKLKGPK
2960 2970 2980 2990 3000
FKMPEMNIKA PKIPMPDFDL HLKGPKVKGD VDISLPKVEG DLKGPEVDIR
3010 3020 3030 3040 3050
GPQVDIDVPD VGVQGPDWHL KMPKVKMPKF SMPGFKGEGP DVDVNLPKAD
3060 3070 3080 3090 3100
LDVSGPKVDI DVPDVNIEGP EGKLKGPKFK MPEMNIKAPK ISMPDIDLNL
3110 3120 3130 3140 3150
KGPKVKGDMD VSLPKVEGDM KVPDVDIKGP KVDINAPDVD VQGPDWHLKM
3160 3170 3180 3190 3200
PKIKMPKISM PGFKGEGPEV DVNLPKADLD VSGPKVDVDV PDVNIEGPDA
3210 3220 3230 3240 3250
KLKGPKFKMP EMNIKAPKIS MPDLDLNLKG PKMKGEVDVS LANVEGDLKG
3260 3270 3280 3290 3300
PALDIKGPKI DVDAPDIDIH GPDAKLKGPK LKMPDMHVNM PKISMPEIDL
3310 3320 3330 3340 3350
NLKGSKLKGD VDVSGPKLEG DIKAPSLDIK GPEVDVSGPK LNIEGKSKKS
3360 3370 3380 3390 3400
RFKLPKFNFS GSKVQTPEVD VKGKKPDIDI TGPKVDINAP DVEVQGKVKG
3410 3420 3430 3440 3450
SKFKMPFLSI SSPKVSMPDV ELNLKSPKVK GDLDIAGPNL EGDFKGPKVD
3460 3470 3480 3490 3500
IKAPEVNLNA PDVDVHGPDW NLKMPKMKMP KFSVSGLKAE GPDVAVDLPK
3510 3520 3530 3540 3550
GDINIEGPSM NIEGPDLNVE GPEGGLKGPK FKMPDMNIKA PKISMPDIDL
3560 3570 3580 3590 3600
NLKGPKVKGD VDISLPKLEG DLKGPEVDIK GPKVDINAPD VDVHGPDWHL
3610 3620 3630 3640 3650
KMPKVKMPKF SMPGFKGEGP EVDVTLPKAD IDISGPNVDV DVPDVNIEGP
3660 3670 3680 3690 3700
DAKLKGPKFK MPEMNIKAPK ISMPDFDLNL KGPKMKGDVV VSLPKVEGDL
3710 3720 3730 3740 3750
KGPEVDIKGP KVDIDTPDIN IEGSEGKFKG PKFKIPEMHL KAPKISMPDI
3760 3770 3780 3790 3800
DLNLKGPKVK GDVDVSLPKM EGDLKGPEVD IKGPKVDINA PDVDVQGPDW
3810 3820 3830 3840 3850
HLKMPKVKMP KFSMPGFKGE GPDVDVNLPK ADLDVSGPKV DIDVPDVNIE
3860 3870 3880 3890 3900
GPEGKLKGPK FKMPEMNIKA PKISMPDIDL NLKGPKVKGD MDVSLPKVEG
3910 3920 3930 3940 3950
DMQVPDLDIK GPKVDINAPD VDVRGPDWHL KMPKIKMPKI SMPGFKGEGP
3960 3970 3980 3990 4000
EVDVNLPKAD LDVSGPKVDV DVPDVNIEGP DAKLKGPKFK MPEMNIKAPK
4010 4020 4030 4040 4050
ISMPDFDLHL KGPKVKGDVD VSLPKMEGDL KAPEVDIKGP KVDIDAPDVD
4060 4070 4080 4090 4100
VHGPDWHLKM PKVKMPKFSM PGFKGEGPEV DVNLPKADID VSGPKVDIDT
4110 4120 4130 4140 4150
PDIDIHGPEG KLKGPKFKMP DLHLKAPKIS MPEVDLNLKG PKMKGDVDVS
4160 4170 4180 4190 4200
LPKVEGDLKG PEVDIKGPKV DIDVPDVDVQ GPDWHLKMPK VKMPKFSMPG
4210 4220 4230 4240 4250
FKGEGPDVDV NLPKADLDVS GPKVDIDVPD VNIEGPDAKL KGPKFKMPEM
4260 4270 4280 4290 4300
NIKAPKISMP DFDLHLKGPK VKGDVDVSLP KVEGDLKGPE VDIKGPKVDI
4310 4320 4330 4340 4350
DAPDVDVHGP DWHLKMPKVK MPKFSMPGFK GEGPDVDVTL PKADIEISGP
4360 4370 4380 4390 4400
KVDIDAPDVS IEGPDAKLKG PKFKMPEMNI KAPKISMPDI DFNLKGPKVK
4410 4420 4430 4440 4450
GDVDVSLPKV EGDLKGPEID IKGPSLDIDT PDVNIEGPEG KLKGPKFKMP
4460 4470 4480 4490 4500
EMNIKAPKIS MPDFDLHLKG PKVKGDVDVS LPKVESDLKG PEVDIEGPEG
4510 4520 4530 4540 4550
KLKGPKFKMP DVHFKSPQIS MSDIDLNLKG PKIKGDMDIS VPKLEGDLKG
4560 4570 4580 4590 4600
PKVDVKGPKV GIDTPDIDIH GPEGKLKGPK FKMPDLHLKA PKISMPEVDL
4610 4620 4630 4640 4650
NLKGPKVKGD MDISLPKVEG DLKGPEVDIR DPKVDIDVPD VDVQGPDWHL
4660 4670 4680 4690 4700
KMPKVKMPKF SMPGFKGEGP DVDVNLPKAD IDVSGPKVDV DVPDVNIEGP
4710 4720 4730 4740 4750
DAKLKGPKFK MPEMSIKAPK ISMPDIDLNL KGPKVKGDVD VTLPKVEGDL
4760 4770 4780 4790 4800
KGPEADIKGP KVDINTPDVD VHGPDWHLKM PKVKMPKFSM PGFKGEGPDV
4810 4820 4830 4840 4850
DVSLPKADID VSGPKVDVDI PDVNIEGPDA KLKGPKFKMP EINIKAPKIS
4860 4870 4880 4890 4900
IPDVDLDLKG PKVKGDFDVS VPKVEGTLKG PEVDLKGPRL DFEGPDAKLS
4910 4920 4930 4940 4950
GPSLKMPSLE ISAPKVTAPD VDLHLKAPKI GFSGPKLEGG EVDLKGPKVE
4960 4970 4980 4990 5000
APSLDVHMDS PDINIEGPDV KIPKFKKPKF GFGAKSPKAD IKSPSLDVTV
5010 5020 5030 5040 5050
PEAELNLETP EISVGGKGKK SKFKMPKIHM SGPKIKAKKQ GFDLNVPGGE
5060 5070 5080 5090 5100
IDASLKAPDV DVNIAGPDAA LKVDVKSPKT KKTMFGKMYF PDVEFDIKSP
5110 5120 5130 5140 5150
KFKAEAPLPS PKLEGELQAP DLELSLPAIH VEGLDIKAKA PKVKMPDVDI
5160 5170 5180 5190 5200
SVPKIEGDLK GPKVQANLGA PDINIEGLDA KVKTPSFGIS APQVSIPDVN
5210 5220 5230 5240 5250
VNLKGPKIKG DVPSVGLEGP DVDLQGPEAK IKFPKFSMPK IGIPGVKMEG
5260 5270 5280 5290 5300
GGAEVHAQLP SLEGDLRGPD VKLEGPDVSL KGPGVDLPSV NLSMPKVSGP
5310 5320 5330 5340 5350
DLDLNLKGPS LKGDLDASVP SMKVHAPGLN LSGVGGKMQV GGDGVKVPGI
5360 5370 5380 5390 5400
DATTKLNVGA PDVTLRGPSL QGDLAVSGDI KCPKVSVGAP DLSLEASEGS
5410 5420 5430 5440 5450
IKLPKMKLPQ FGISTPGSDL HVNAKGPQVS GELKGPGVDV NLKGPRISAP
5460 5470 5480 5490 5500
NVDFNLEGPK VKGSLGATGE IKGPTVGGGL PGIGVQGLEG NLQMPGIKSS
5510 5520 5530 5540 5550
GCDVNLPGVN VKLPTGQISG PEIKGGLKGS EVGFHGAAPD ISVKGPAFNM
5560 5570 5580 5590 5600
ASPESDFGIN LKGPKIKGGA DVSGGVSAPD ISLGEGHLSV KGSGGEWKGP
5610 5620 5630 5640 5650
QVSSALNLDT SKFAGGLHFS GPKVEGGVKG GQIGLQAPGL SVSGPQGHLE
5660 5670 5680 5690 5700
SGSGKVTFPK MKIPKFTFSG RELVGREMGV DVHFPKAEAS IQAGAGDGEW
5710 5720 5730 5740 5750
EESEVKLKKS KIKMPKFNFS KPKGKGGVTG SPEASISGSK GDLKSSKASL
5760 5770 5780 5790 5800
GSLEGEAEAE ASSPKGKFSL FKSKKPRHRS NSFSDEREFS GPSTPTGTLE
5810 5820 5830 5840 5850
FEGGEVSLEG GKVKGKHGKL KFGTFGGLGS KSKGHYEVTG SDDETGKLQG
5860 5870 5880 5890
SGVSLASKKS RLSSSSSNDS GNKVGIQLPE VELSVSTKKE
Length:5,890
Mass (Da):629,101
Last modified:November 13, 2007 - v2
Checksum:iA82FC9645FDCA8DC
GO
Isoform 2 (identifier: Q09666-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     115-149: SGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSR → NTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
     150-5890: Missing.

Show »
Length:149
Mass (Da):16,061
Checksum:i4CB0471C1B60F60D
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PJZ0E9PJZ0_HUMAN
Neuroblast differentiation-associat...
AHNAK
121Annotation score:
E9PLK4E9PLK4_HUMAN
Neuroblast differentiation-associat...
AHNAK
144Annotation score:
E9PKR9E9PKR9_HUMAN
Neuroblast differentiation-associat...
AHNAK
123Annotation score:
E9PJC6E9PJC6_HUMAN
Neuroblast differentiation-associat...
AHNAK
131Annotation score:
E9PQE3E9PQE3_HUMAN
Neuroblast differentiation-associat...
AHNAK
85Annotation score:

Sequence cautioni

The sequence AAA69899 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti288A → P in AAA69899 (PubMed:1608957).Curated1
Sequence conflicti302G → A in AAA69899 (PubMed:1608957).Curated1
Sequence conflicti1156V → D in AAA69899 (PubMed:1608957).Curated1
Sequence conflicti1737P → R in AAA69899 (PubMed:1608957).Curated1
Sequence conflicti1821F → L in AAA69899 (PubMed:1608957).Curated1
Sequence conflicti4614S → T in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti4627V → A in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti4630 – 4631RD → KG in AAA69898 (PubMed:1608957).Curated2
Sequence conflicti4637 – 4638DV → NT in AAA69898 (PubMed:1608957).Curated2
Sequence conflicti4644Q → H in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti4830A → P in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti4834G → V in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti4837F → V in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti4984A → P in AAA69898 (PubMed:1608957).Curated1
Sequence conflicti5445P → S in AAA69898 (PubMed:1608957).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039058962G → V. Corresponds to variant dbSNP:rs664761Ensembl.1
Natural variantiVAR_0390592114A → T. Corresponds to variant dbSNP:rs1298288Ensembl.1
Natural variantiVAR_0615512247K → T. Corresponds to variant dbSNP:rs61524789Ensembl.1
Natural variantiVAR_0390602439P → L. Corresponds to variant dbSNP:rs11824660Ensembl.1
Natural variantiVAR_0390613003Q → K. Corresponds to variant dbSNP:rs566144Ensembl.1
Natural variantiVAR_0390623190V → I. Corresponds to variant dbSNP:rs11231129Ensembl.1
Natural variantiVAR_0390633724S → P. Corresponds to variant dbSNP:rs11231128Ensembl.1
Natural variantiVAR_0615524304D → G. Corresponds to variant dbSNP:rs11828907Ensembl.1
Natural variantiVAR_0390644561G → D. Corresponds to variant