Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 181 (11 Dec 2019)
Sequence version 3 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lactadherin

Gene

MFGE8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.By similarity1 Publication
Medin is the main constituent of aortic medial amyloid.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAngiogenesis, Cell adhesion, Fertilization

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-8957275 Post-translational protein phosphorylation
R-HSA-977225 Amyloid fiber formation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lactadherin
Alternative name(s):
Breast epithelial antigen BA46
HMFG
MFGM
Milk fat globule-EGF factor 8
Short name:
MFG-E8
SED1
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MFGE8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000140545.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7036 MFGE8

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602281 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q08431

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Amyloid, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4240

Open Targets

More...
OpenTargetsi
ENSG00000140545

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30772

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q08431 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3713343

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MFGE8

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2506380

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Add BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000765024 – 387LactadherinAdd BLAST364
ChainiPRO_0000007651202 – 387Lactadherin short formAdd BLAST186
ChainiPRO_0000007652268 – 317MedinAdd BLAST50

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi27 ↔ 38By similarity
Disulfide bondi32 ↔ 55By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei42Phosphoserine; by FAM20C1 Publication1
Disulfide bondi57 ↔ 66By similarity
Disulfide bondi70 ↔ 225By similarity
Disulfide bondi212 ↔ 216By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi228N-linked (GlcNAc...) asparagine; atypical1 Publication1
Disulfide bondi230 ↔ 387By similarity
Glycosylationi238N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi325N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi329N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi350N-linked (GlcNAc...) asparagine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Medin has a ragged N-terminus with minor species starting at Pro-264 and Gly-273.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q08431

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q08431

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q08431

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q08431

PeptideAtlas

More...
PeptideAtlasi
Q08431

PRoteomics IDEntifications database

More...
PRIDEi
Q08431

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25082
58610 [Q08431-1]
58611 [Q08431-2]
58612 [Q08431-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1437

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q08431

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q08431

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140545 Expressed in 207 organ(s), highest expression level in descending thoracic aorta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q08431 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q08431 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB002753
HPA002807

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110398, 6 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q08431

Protein interaction database and analysis system

More...
IntActi
Q08431, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000268150

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q08431 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q08431

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 67EGF-likePROSITE-ProRule annotationAdd BLAST44
Domaini70 – 225F5/8 type C 1PROSITE-ProRule annotationAdd BLAST156
Domaini230 – 387F5/8 type C 2PROSITE-ProRule annotationAdd BLAST158

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi46 – 48Cell attachment site3

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The F5/8 type C 2 domain mediates high-affinity binding to phosphatidylserine-containing membranes.By similarity

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFBC Eukaryota
ENOG41114BV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156049

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000236278

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q08431

KEGG Orthology (KO)

More...
KOi
K17253

Identification of Orthologs from Complete Genome Data

More...
OMAi
YDRKPWI

Database of Orthologous Groups

More...
OrthoDBi
441415at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q08431

TreeFam database of animal gene trees

More...
TreeFami
TF330156

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00057 FA58C, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.260, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000421 FA58C
IPR008979 Galactose-bd-like_sf
IPR027060 Lactadherin

The PANTHER Classification System

More...
PANTHERi
PTHR24543:SF307 PTHR24543:SF307, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008 EGF, 1 hit
PF00754 F5_F8_type_C, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 1 hit
SM00231 FA58C, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49785 SSF49785, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS01285 FA58C_1, 2 hits
PS01286 FA58C_2, 2 hits
PS50022 FA58C_3, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q08431-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRPRLLAAL CGALLCAPSL LVALDICSKN PCHNGGLCEE ISQEVRGDVF
60 70 80 90 100
PSYTCTCLKG YAGNHCETKC VEPLGLENGN IANSQIAASS VRVTFLGLQH
110 120 130 140 150
WVPELARLNR AGMVNAWTPS SNDDNPWIQV NLLRRMWVTG VVTQGASRLA
160 170 180 190 200
SHEYLKAFKV AYSLNGHEFD FIHDVNKKHK EFVGNWNKNA VHVNLFETPV
210 220 230 240 250
EAQYVRLYPT SCHTACTLRF ELLGCELNGC ANPLGLKNNS IPDKQITASS
260 270 280 290 300
SYKTWGLHLF SWNPSYARLD KQGNFNAWVA GSYGNDQWLQ VDLGSSKEVT
310 320 330 340 350
GIITQGARNF GSVQFVASYK VAYSNDSANW TEYQDPRTGS SKIFPGNWDN
360 370 380
HSHKKNLFET PILARYVRIL PVAWHNRIAL RLELLGC
Length:387
Mass (Da):43,105
Last modified:September 12, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9EA357581933789D
GO
Isoform 2 (identifier: Q08431-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.

Note: It is unsure whether Met-1 or an upstream Met is the initiator as the upstream Met corresponds to polymorphism rs1879326.Curated
Show »
Length:275
Mass (Da):31,185
Checksum:i04F8026A6F93C85C
GO
Isoform 3 (identifier: Q08431-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-342: Missing.

Show »
Length:335
Mass (Da):37,505
Checksum:iBE984E5DDCFE8E25
GO
Isoform 4 (identifier: Q08431-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-69: DICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETK → E

Show »
Length:343
Mass (Da):38,344
Checksum:i6D452CAAA162C320
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YKS8H0YKS8_HUMAN
Lactadherin
MFGE8
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUV5A0A087WUV5_HUMAN
Lactadherin
MFGE8
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKB5H0YKB5_HUMAN
Lactadherin
MFGE8
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti268R → W in CAD97938 (PubMed:17974005).Curated1
Sequence conflicti352S → T in CAD97938 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0297943R → S. Corresponds to variant dbSNP:rs4945Ensembl.1
Natural variantiVAR_02426376L → M5 PublicationsCorresponds to variant dbSNP:rs1878326Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0391081 – 112Missing in isoform 2. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_05981825 – 69DICSK…HCETK → E in isoform 4. Add BLAST45
Alternative sequenceiVSP_039953291 – 342Missing in isoform 3. 2 PublicationsAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U58516 mRNA Translation: AAC50549.1
AY141974 mRNA Translation: AAN08508.1
BT006948 mRNA Translation: AAP35594.1
AK312640 mRNA Translation: BAG35524.1
AK223182 mRNA Translation: BAD96902.1
AK222735 mRNA Translation: BAD96455.1
BX537974 mRNA Translation: CAD97938.1
AC067805 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX02026.1
BC003610 mRNA Translation: AAH03610.1
S56151 mRNA Translation: AAB19771.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10347.1 [Q08431-1]
CCDS45345.1 [Q08431-3]
CCDS81918.1 [Q08431-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A47285

NCBI Reference Sequences

More...
RefSeqi
NP_001108086.1, NM_001114614.2 [Q08431-3]
NP_001297248.1, NM_001310319.1 [Q08431-4]
NP_001297249.1, NM_001310320.1
NP_001297250.1, NM_001310321.1 [Q08431-2]
NP_005919.2, NM_005928.3 [Q08431-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000268150; ENSP00000268150; ENSG00000140545 [Q08431-1]
ENST00000268151; ENSP00000268151; ENSG00000140545 [Q08431-3]
ENST00000542878; ENSP00000444332; ENSG00000140545 [Q08431-4]
ENST00000566497; ENSP00000456281; ENSG00000140545 [Q08431-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4240

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4240

UCSC genome browser

More...
UCSCi
uc002bng.5 human [Q08431-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U58516 mRNA Translation: AAC50549.1
AY141974 mRNA Translation: AAN08508.1
BT006948 mRNA Translation: AAP35594.1
AK312640 mRNA Translation: BAG35524.1
AK223182 mRNA Translation: BAD96902.1
AK222735 mRNA Translation: BAD96455.1
BX537974 mRNA Translation: CAD97938.1
AC067805 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX02026.1
BC003610 mRNA Translation: AAH03610.1
S56151 mRNA Translation: AAB19771.1
CCDSiCCDS10347.1 [Q08431-1]
CCDS45345.1 [Q08431-3]
CCDS81918.1 [Q08431-4]
PIRiA47285
RefSeqiNP_001108086.1, NM_001114614.2 [Q08431-3]
NP_001297248.1, NM_001310319.1 [Q08431-4]
NP_001297249.1, NM_001310320.1
NP_001297250.1, NM_001310321.1 [Q08431-2]
NP_005919.2, NM_005928.3 [Q08431-1]

3D structure databases

SMRiQ08431
ModBaseiSearch...

Protein-protein interaction databases

BioGridi110398, 6 interactors
CORUMiQ08431
IntActiQ08431, 5 interactors
STRINGi9606.ENSP00000268150

Chemistry databases

ChEMBLiCHEMBL3713343

PTM databases

GlyConnecti1437
iPTMnetiQ08431
PhosphoSitePlusiQ08431

Polymorphism and mutation databases

BioMutaiMFGE8
DMDMi2506380

Proteomic databases

EPDiQ08431
jPOSTiQ08431
MassIVEiQ08431
PaxDbiQ08431
PeptideAtlasiQ08431
PRIDEiQ08431
ProteomicsDBi25082
58610 [Q08431-1]
58611 [Q08431-2]
58612 [Q08431-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q08431

The DNASU plasmid repository

More...
DNASUi
4240

Genome annotation databases

EnsembliENST00000268150; ENSP00000268150; ENSG00000140545 [Q08431-1]
ENST00000268151; ENSP00000268151; ENSG00000140545 [Q08431-3]
ENST00000542878; ENSP00000444332; ENSG00000140545 [Q08431-4]
ENST00000566497; ENSP00000456281; ENSG00000140545 [Q08431-1]
GeneIDi4240
KEGGihsa:4240
UCSCiuc002bng.5 human [Q08431-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4240
DisGeNETi4240
EuPathDBiHostDB:ENSG00000140545.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MFGE8
HGNCiHGNC:7036 MFGE8
HPAiCAB002753
HPA002807
MIMi602281 gene
neXtProtiNX_Q08431
OpenTargetsiENSG00000140545
PharmGKBiPA30772

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFBC Eukaryota
ENOG41114BV LUCA
GeneTreeiENSGT00940000156049
HOGENOMiHOG000236278
InParanoidiQ08431
KOiK17253
OMAiYDRKPWI
OrthoDBi441415at2759
PhylomeDBiQ08431
TreeFamiTF330156

Enzyme and pathway databases

ReactomeiR-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-8957275 Post-translational protein phosphorylation
R-HSA-977225 Amyloid fiber formation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MFGE8 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MFGE8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4240
PharosiQ08431 Tbio

Protein Ontology

More...
PROi
PR:Q08431
RNActiQ08431 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140545 Expressed in 207 organ(s), highest expression level in descending thoracic aorta
ExpressionAtlasiQ08431 baseline and differential
GenevisibleiQ08431 HS

Family and domain databases

CDDicd00057 FA58C, 2 hits
Gene3Di2.60.120.260, 2 hits
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000421 FA58C
IPR008979 Galactose-bd-like_sf
IPR027060 Lactadherin
PANTHERiPTHR24543:SF307 PTHR24543:SF307, 2 hits
PfamiView protein in Pfam
PF00008 EGF, 1 hit
PF00754 F5_F8_type_C, 2 hits
SMARTiView protein in SMART
SM00181 EGF, 1 hit
SM00231 FA58C, 2 hits
SUPFAMiSSF49785 SSF49785, 2 hits
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS01285 FA58C_1, 2 hits
PS01286 FA58C_2, 2 hits
PS50022 FA58C_3, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMFGM_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q08431
Secondary accession number(s): B2R6M7
, F5GZN3, Q53FU9, Q7Z3D2, Q9BTL9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: September 12, 2018
Last modified: December 11, 2019
This is version 181 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again