Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q08289 (CACB2_HUMAN)

Entry version 200 (12 Aug 2020)
Sequence version 3 (17 Apr 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

CACNB2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei549Required for CaMK2D-bindingBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q08289

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-112308, Presynaptic depolarization and calcium channel opening
R-HSA-400042, Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037, NCAM1 interactions
R-HSA-422356, Regulation of insulin secretion
R-HSA-5576892, Phase 0 - rapid depolarisation
R-HSA-5576893, Phase 2 - plateau phase

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q08289

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q08289

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.22.1.2, the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Lambert-Eaton myasthenic syndrome antigen B
Short name:
MYSB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACNB2
Synonyms:CACNLB2, MYSB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000165995.18

Human Gene Nomenclature Database

More...HGNCi		HGNC:1402, CACNB2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600003, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q08289

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Brugada syndrome 4 (BRGDA4)1 Publication
The gene represented in this entry may be involved in disease pathogenesis.
Disease descriptionA heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs, the individual will faint and may die in a few minutes if the heart is not reset.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_044041535S → L in BRGDA4; unknown pathological significance; affects channel activity. 1 PublicationCorresponds to variant dbSNP:rs121917812EnsemblClinVar.1

Keywords - Diseasei

Brugada syndrome, Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		783

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		CACNB2

MalaCards human disease database

More...MalaCardsi		CACNB2
MIMi611876, phenotype

Open Targets

More...OpenTargetsi		ENSG00000165995

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		130, Brugada syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA88

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q08289, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3317336

Drug and drug target database

More...DrugBanki		DB01118, Amiodarone
DB09231, Benidipine
DB13746, Bioallethrin
DB11148, Butamben
DB11093, Calcium citrate
DB11348, Calcium Phosphate
DB14481, Calcium phosphate dihydrate
DB09232, Cilnidipine
DB04855, Dronedarone
DB00153, Ergocalciferol
DB01023, Felodipine
DB13961, Fish oil
DB00270, Isradipine
DB09236, Lacidipine
DB00825, Levomenthol
DB00653, Magnesium sulfate
DB09238, Manidipine
DB01388, Mibefradil
DB00622, Nicardipine
DB01115, Nifedipine
DB06712, Nilvadipine
DB00393, Nimodipine
DB00401, Nisoldipine
DB01054, Nitrendipine
DB00252, Phenytoin
DB00243, Ranolazine
DB00421, Spironolactone
DB00273, Topiramate
DB09089, Trimebutine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CACNB2

Domain mapping of disease mutations (DMDM)

More...DMDMi		145559447

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001440511 – 660Voltage-dependent L-type calcium channel subunit beta-2Add BLAST660

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei204PhosphoserineBy similarity1
Modified residuei207PhosphoserineBy similarity1
Modified residuei218PhosphoserineBy similarity1
Modified residuei550PhosphoserineBy similarity1
Modified residuei554Phosphothreonine; by CaMK2DBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Regulated through phosphorylation at Thr-554 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q08289

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q08289

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q08289

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q08289

PeptideAtlas

More...PeptideAtlasi		Q08289

PRoteomics IDEntifications database

More...PRIDEi		Q08289

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		1694
58586 [Q08289-1]
58587 [Q08289-2]
58588 [Q08289-3]
58589 [Q08289-4]
58590 [Q08289-5]
58591 [Q08289-6]
58592 [Q08289-7]
58593 [Q08289-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q08289

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q08289

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000165995, Expressed in heart and 192 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q08289, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q08289, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000165995, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and CACNA2D1. The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio, i.e. it contains either CACNB1 or CACNB2.

Interacts with CACNA1C (By similarity).

Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane (PubMed:17525370).

Interacts with TMIGD2 (PubMed:22419821).

Interacts with CAMK2D.

Interacts with CBARP (By similarity).

Interacts with CAMK2A (PubMed:28130356).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107237, 4 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-3195, Cardiac muscle VGCC complex

Protein interaction database and analysis system

More...IntActi		Q08289, 9 interactors

Molecular INTeraction database

More...MINTi		Q08289

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000320025

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q08289

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q08289, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q08289

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini114 – 183SH3PROSITE-ProRule annotationAdd BLAST70

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the calcium channel beta subunit family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3812, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182837

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021995_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q08289

KEGG Orthology (KO)

More...KOi		K04863

Identification of Orthologs from Complete Genome Data

More...OMAi		IVVYVKI

Database of Orthologous Groups

More...OrthoDBi		926074at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q08289

TreeFam database of animal gene trees

More...TreeFami		TF316195

Family and domain databases

Conserved Domains Database

More...CDDi		cd12040, SH3_CACNB2, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035605, CACNB2_SH3
IPR008145, GK/Ca_channel_bsu
IPR027417, P-loop_NTPase
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR005444, VDCC_L_b2su
IPR000584, VDCC_L_bsu

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF12052, VGCC_beta4Aa_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01626, LCACHANNELB
PR01628, LCACHANNELB2

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00072, GuKc, 1 hit
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044, SSF50044, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2d (identifier: Q08289-1) [UniParc]FASTAAdd to basket
Also known as: CACNB2d

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQRDMSKSP PTAAAAVAQE IQMELLENVA PAGALGAAAQ SYGKGARRKN 
        60         70         80         90        100
RFKGSDGSTS SDTTSNSFVR QGSADSYTSR PSDSDVSLEE DREAVRREAE 
       110        120        130        140        150
RQAQAQLEKA KTKPVAFAVR TNVSYSAAHE DDVPVPGMAI SFEAKDFLHV 
       160        170        180        190        200
KEKFNNDWWI GRLVKEGCEI GFIPSPVKLE NMRLQHEQRA KQGKFYSSKS 
       210        220        230        240        250
GGNSSSSLGD IVPSSRKSTP PSSAIDIDAT GLDAEENDIP ANHRSPKPSA 
       260        270        280        290        300
NSVTSPHSKE KRMPFFKKTE HTPPYDVVPS MRPVVLVGPS LKGYEVTDMM 
       310        320        330        340        350
QKALFDFLKH RFEGRISITR VTADISLAKR SVLNNPSKHA IIERSNTRSS 
       360        370        380        390        400
LAEVQSEIER IFELARTLQL VVLDADTINH PAQLSKTSLA PIIVYVKISS 
       410        420        430        440        450
PKVLQRLIKS RGKSQAKHLN VQMVAADKLA QCPPELFDVI LDENQLEDAC 
       460        470        480        490        500
EHLADYLEAY WKATHPPSSS LPNPLLSRTL ATSSLPLSPT LASNSQGSQG 
       510        520        530        540        550
DQRTDRSAPI RSASQAEEEP SVEPVKKSQH RSSSSAPHHN HRSGTSRGLS 
       560        570        580        590        600
RQETFDSETQ ESRDSAYVEP KEDYSHDHVD HYASHRDHNH RDETHGSSDH 
       610        620        630        640        650
RHRESRHRSR DVDREQDHNE CNKQRSRHKS KDRYCEKDGE VISKKRNEAG 
       660
EWNRDVYIRQ
Length:660
Mass (Da):73,581
Last modified:April 17, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4A08B141EE66404E
GO
Isoform 2a (identifier: Q08289-2) [UniParc]FASTAAdd to basket
Also known as: CACNB2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

Show »
Length:605
Mass (Da):68,142
Checksum:i710A5E734B7442DD
GO
Isoform 2b (identifier: Q08289-3) [UniParc]FASTAAdd to basket
Also known as: CACNB2b, 2aN4

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG

Show »
Length:606
Mass (Da):68,164
Checksum:iF4A4A1BAE6A105F0
GO
Isoform 2c (identifier: Q08289-4) [UniParc]FASTAAdd to basket
Also known as: CACNB2c, 2aN2

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI

Show »
Length:632
Mass (Da):70,832
Checksum:iFBD00FB30E47E5FB
GO
Isoform 2e (identifier: Q08289-5) [UniParc]FASTAAdd to basket
Also known as: CACNB2e

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKNSDIC

Show »
Length:612
Mass (Da):68,838
Checksum:i1D60077179676927
GO
Isoform 2f (identifier: Q08289-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS

Show »
Length:567
Mass (Da):64,010
Checksum:iCBCD97B7822B92E6
GO
Isoform 2g (identifier: Q08289-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS

Show »
Length:622
Mass (Da):69,449
Checksum:i9FBABEC5BE5DD074
GO
Isoform 2h (identifier: Q08289-8) [UniParc]FASTAAdd to basket
Also known as: 2cN1

The sequence of this isoform differs from the canonical sequence as follows:
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Show »
Length:636
Mass (Da):71,075
Checksum:i71521EDDD736A9CF
GO
Isoform 2cN2 (identifier: Q08289-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Show »
Length:608
Mass (Da):68,326
Checksum:i45DCA4A5AF7ACAF4
GO
Isoform 2cN4 (identifier: Q08289-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Show »
Length:582
Mass (Da):65,658
Checksum:i4AC64252EDD46ABB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WVX5A0A087WVX5_HUMAN
Calcium channel voltage-dependent s...
CACNB2
581Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C0B2A0A494C0B2_HUMAN
Calcium channel voltage-dependent s...
CACNB2
574Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C184A0A494C184_HUMAN
Calcium channel voltage-dependent s...
CACNB2
600Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y555A0A2R8Y555_HUMAN
Calcium channel voltage-dependent s...
CACNB2
584Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZM7A0A2U3TZM7_HUMAN
Calcium channel voltage-dependent s...
CACNB2
529Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C0Z9A0A494C0Z9_HUMAN
Calcium channel voltage-dependent s...
CACNB2
269Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6TME0Q6TME0_HUMAN
Calcium channel voltage-dependent s...
CACNB2
176Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7A6A0A2R8Y7A6_HUMAN
Calcium channel voltage-dependent s...
CACNB2
220Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFX9A0A2R8YFX9_HUMAN
Calcium channel voltage-dependent s...
CACNB2
240Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C0C3A0A494C0C3_HUMAN
Calcium channel voltage-dependent s...
CACNB2
150Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB51370 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti56D → N in AAQ97608 (PubMed:14762176).Curated1
Sequence conflicti69V → L in AAD33729 (Ref. 5) Curated1
Sequence conflicti100 – 101ER → Q in AAD33729 (Ref. 5) Curated2
Sequence conflicti122N → D in AAD33729 (Ref. 5) Curated1
Sequence conflicti364L → V in AAD33729 (Ref. 5) Curated1
Sequence conflicti364L → V in AAD33730 (Ref. 5) Curated1
Sequence conflicti406R → T in AAD33729 (Ref. 5) Curated1
Sequence conflicti406R → T in AAD33730 (Ref. 5) Curated1
Sequence conflicti501D → H in AAD33729 (Ref. 5) Curated1
Sequence conflicti501D → H in AAD33730 (Ref. 5) Curated1
Sequence conflicti524P → G in AAD33729 (Ref. 5) Curated1
Sequence conflicti524P → G in AAD33730 (Ref. 5) Curated1
Sequence conflicti624Q → QQ in AAD33729 (Ref. 5) Curated1
Sequence conflicti624Q → QQ in AAD33730 (Ref. 5) Curated1
Sequence conflicti659R → P in AAB53332 (PubMed:9254841).Curated1
Sequence conflicti659R → P in AAG01473 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAL16948 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAL16951 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAL16950 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAQ97606 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97607 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97608 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97609 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97610 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAL73495 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03635099A → G in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs745502425Ensembl.1
Natural variantiVAR_044041535S → L in BRGDA4; unknown pathological significance; affects channel activity. 1 PublicationCorresponds to variant dbSNP:rs121917812EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0006271 – 71MVQRD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2a and isoform 2f. 5 PublicationsAdd BLAST71
Alternative sequenceiVSP_0006281 – 71MVQRD…SFVRQ → MLDRRLIAPQTKYIIPG in isoform 2b and isoform 2cN4. 2 PublicationsAdd BLAST71
Alternative sequenceiVSP_0006291 – 71MVQRD…SFVRQ → MKATWIRLLKRAKGGRLKNS DIC in isoform 2e. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_0006261 – 40MVQRD…GAAAQ → MNQGSGLDLLKI in isoform 2c and isoform 2cN2. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_000630224 – 268AIDID…PFFKK → AKQKQKS in isoform 2f and isoform 2g. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_000631224 – 268AIDID…PFFKK → GAKSADEQDQWKTAGLFWRF T in isoform 2h, isoform 2cN2 and isoform 2cN4. 2 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
S60415 mRNA Translation: AAB51370.1 Frameshift.
U95019 mRNA Translation: AAB53332.1
AF423189 mRNA Translation: AAL16948.1
AF423190 mRNA Translation: AAL16949.1
AF423191 mRNA Translation: AAL16950.1
AF423192 mRNA Translation: AAL16951.1
AF285239 mRNA Translation: AAG01473.2
AY393858 mRNA Translation: AAQ97606.1
AY393859 mRNA Translation: AAQ97607.1
AY393860 mRNA Translation: AAQ97608.1
AY393861 mRNA Translation: AAQ97609.1
AY393862 mRNA Translation: AAQ97610.1
AF137376 mRNA Translation: AAD33729.1
AF137377 mRNA Translation: AAD33730.1
AY027898 AY027897 Genomic DNA Translation: AAK16994.1
AF465485 mRNA Translation: AAL73495.1
AL139814 Genomic DNA No translation available.
AL360231 Genomic DNA No translation available.
AL390783 Genomic DNA No translation available.
AL450364 Genomic DNA No translation available.
AL450384 Genomic DNA No translation available.
AL353603 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86196.1
CH471072 Genomic DNA Translation: EAW86197.1
BC136409 mRNA Translation: AAI36410.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41493.1 [Q08289-9]
CCDS41494.1 [Q08289-3]
CCDS7125.1 [Q08289-1]
CCDS7126.1 [Q08289-8]
CCDS7127.1 [Q08289-4]
CCDS7128.1 [Q08289-2]
CCDS7129.1 [Q08289-5]
CCDS81442.1 [Q08289-6]

Protein sequence database of the Protein Information Resource

More...PIRi		A48895

NCBI Reference Sequences

More...RefSeqi		NP_000715.2, NM_000724.3 [Q08289-2]
NP_001316989.1, NM_001330060.1 [Q08289-6]
NP_963864.1, NM_201570.2 [Q08289-5]
NP_963865.2, NM_201571.3 [Q08289-4]
NP_963866.2, NM_201572.3 [Q08289-9]
NP_963884.2, NM_201590.2 [Q08289-3]
NP_963887.2, NM_201593.2 [Q08289-7]
NP_963890.2, NM_201596.2 [Q08289-1]
NP_963891.1, NM_201597.2 [Q08289-8]
XP_011517961.1, XM_011519659.2 [Q08289-10]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000282343; ENSP00000282343; ENSG00000165995 [Q08289-4]
ENST00000324631; ENSP00000320025; ENSG00000165995 [Q08289-1]
ENST00000352115; ENSP00000344474; ENSG00000165995 [Q08289-8]
ENST00000377315; ENSP00000366532; ENSG00000165995 [Q08289-5]
ENST00000377319; ENSP00000366536; ENSG00000165995 [Q08289-6]
ENST00000377329; ENSP00000366546; ENSG00000165995 [Q08289-3]
ENST00000396576; ENSP00000379821; ENSG00000165995 [Q08289-2]
ENST00000645287; ENSP00000496203; ENSG00000165995 [Q08289-9]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		783

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:783

UCSC genome browser

More...UCSCi		uc001ipr.3, human [Q08289-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S60415 mRNA Translation: AAB51370.1 Frameshift.
U95019 mRNA Translation: AAB53332.1
AF423189 mRNA Translation: AAL16948.1
AF423190 mRNA Translation: AAL16949.1
AF423191 mRNA Translation: AAL16950.1
AF423192 mRNA Translation: AAL16951.1
AF285239 mRNA Translation: AAG01473.2
AY393858 mRNA Translation: AAQ97606.1
AY393859 mRNA Translation: AAQ97607.1
AY393860 mRNA Translation: AAQ97608.1
AY393861 mRNA Translation: AAQ97609.1
AY393862 mRNA Translation: AAQ97610.1
AF137376 mRNA Translation: AAD33729.1
AF137377 mRNA Translation: AAD33730.1
AY027898 AY027897 Genomic DNA Translation: AAK16994.1
AF465485 mRNA Translation: AAL73495.1
AL139814 Genomic DNA No translation available.
AL360231 Genomic DNA No translation available.
AL390783 Genomic DNA No translation available.
AL450364 Genomic DNA No translation available.
AL450384 Genomic DNA No translation available.
AL353603 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86196.1
CH471072 Genomic DNA Translation: EAW86197.1
BC136409 mRNA Translation: AAI36410.1
CCDSiCCDS41493.1 [Q08289-9]
CCDS41494.1 [Q08289-3]
CCDS7125.1 [Q08289-1]
CCDS7126.1 [Q08289-8]
CCDS7127.1 [Q08289-4]
CCDS7128.1 [Q08289-2]
CCDS7129.1 [Q08289-5]
CCDS81442.1 [Q08289-6]
PIRiA48895
RefSeqiNP_000715.2, NM_000724.3 [Q08289-2]
NP_001316989.1, NM_001330060.1 [Q08289-6]
NP_963864.1, NM_201570.2 [Q08289-5]
NP_963865.2, NM_201571.3 [Q08289-4]
NP_963866.2, NM_201572.3 [Q08289-9]
NP_963884.2, NM_201590.2 [Q08289-3]
NP_963887.2, NM_201593.2 [Q08289-7]
NP_963890.2, NM_201596.2 [Q08289-1]
NP_963891.1, NM_201597.2 [Q08289-8]
XP_011517961.1, XM_011519659.2 [Q08289-10]

3D structure databases

SMRiQ08289
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107237, 4 interactors
ComplexPortaliCPX-3195, Cardiac muscle VGCC complex
IntActiQ08289, 9 interactors
MINTiQ08289
STRINGi9606.ENSP00000320025

Chemistry databases

BindingDBiQ08289
ChEMBLiCHEMBL3317336
DrugBankiDB01118, Amiodarone
DB09231, Benidipine
DB13746, Bioallethrin
DB11148, Butamben
DB11093, Calcium citrate
DB11348, Calcium Phosphate
DB14481, Calcium phosphate dihydrate
DB09232, Cilnidipine
DB04855, Dronedarone
DB00153, Ergocalciferol
DB01023, Felodipine
DB13961, Fish oil
DB00270, Isradipine
DB09236, Lacidipine
DB00825, Levomenthol
DB00653, Magnesium sulfate
DB09238, Manidipine
DB01388, Mibefradil
DB00622, Nicardipine
DB01115, Nifedipine
DB06712, Nilvadipine
DB00393, Nimodipine
DB00401, Nisoldipine
DB01054, Nitrendipine
DB00252, Phenytoin
DB00243, Ranolazine
DB00421, Spironolactone
DB00273, Topiramate
DB09089, Trimebutine

Protein family/group databases

TCDBi8.A.22.1.2, the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

PTM databases

iPTMnetiQ08289
PhosphoSitePlusiQ08289

Polymorphism and mutation databases

BioMutaiCACNB2
DMDMi145559447

Proteomic databases

jPOSTiQ08289
MassIVEiQ08289
MaxQBiQ08289
PaxDbiQ08289
PeptideAtlasiQ08289
PRIDEiQ08289
ProteomicsDBi1694
58586 [Q08289-1]
58587 [Q08289-2]
58588 [Q08289-3]
58589 [Q08289-4]
58590 [Q08289-5]
58591 [Q08289-6]
58592 [Q08289-7]
58593 [Q08289-8]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		12067, 554 antibodies

Genome annotation databases

EnsembliENST00000282343; ENSP00000282343; ENSG00000165995 [Q08289-4]
ENST00000324631; ENSP00000320025; ENSG00000165995 [Q08289-1]
ENST00000352115; ENSP00000344474; ENSG00000165995 [Q08289-8]
ENST00000377315; ENSP00000366532; ENSG00000165995 [Q08289-5]
ENST00000377319; ENSP00000366536; ENSG00000165995 [Q08289-6]
ENST00000377329; ENSP00000366546; ENSG00000165995 [Q08289-3]
ENST00000396576; ENSP00000379821; ENSG00000165995 [Q08289-2]
ENST00000645287; ENSP00000496203; ENSG00000165995 [Q08289-9]
GeneIDi783
KEGGihsa:783
UCSCiuc001ipr.3, human [Q08289-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		783
DisGeNETi783
EuPathDBiHostDB:ENSG00000165995.18

GeneCards: human genes, protein and diseases

More...GeneCardsi		CACNB2
GeneReviewsiCACNB2
HGNCiHGNC:1402, CACNB2
HPAiENSG00000165995, Low tissue specificity
MalaCardsiCACNB2
MIMi600003, gene
611876, phenotype
neXtProtiNX_Q08289
OpenTargetsiENSG00000165995
Orphaneti130, Brugada syndrome
PharmGKBiPA88

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3812, Eukaryota
GeneTreeiENSGT00950000182837
HOGENOMiCLU_021995_3_0_1
InParanoidiQ08289
KOiK04863
OMAiIVVYVKI
OrthoDBi926074at2759
PhylomeDBiQ08289
TreeFamiTF316195

Enzyme and pathway databases

PathwayCommonsiQ08289
ReactomeiR-HSA-112308, Presynaptic depolarization and calcium channel opening
R-HSA-400042, Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037, NCAM1 interactions
R-HSA-422356, Regulation of insulin secretion
R-HSA-5576892, Phase 0 - rapid depolarisation
R-HSA-5576893, Phase 2 - plateau phase
SignaLinkiQ08289
SIGNORiQ08289

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		783, 4 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CACNB2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CACNB2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		783
PharosiQ08289, Tbio

Protein Ontology

More...PROi		PR:Q08289
RNActiQ08289, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000165995, Expressed in heart and 192 other tissues
ExpressionAtlasiQ08289, baseline and differential
GenevisibleiQ08289, HS

Family and domain databases

CDDicd12040, SH3_CACNB2, 1 hit
InterProiView protein in InterPro
IPR035605, CACNB2_SH3
IPR008145, GK/Ca_channel_bsu
IPR027417, P-loop_NTPase
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR005444, VDCC_L_b2su
IPR000584, VDCC_L_bsu
PfamiView protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF12052, VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626, LCACHANNELB
PR01628, LCACHANNELB2
SMARTiView protein in SMART
SM00072, GuKc, 1 hit
SM00326, SH3, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACB2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q08289
Secondary accession number(s): A6PVM5
, A6PVM7, A6PVM8, O00304, Q5QJ99, Q5QJA0, Q5VVG9, Q5VVH0, Q5VWV6, Q6TME1, Q6TME2, Q6TME3, Q8WX81, Q96NZ3, Q96NZ4, Q96NZ5, Q9BWU2, Q9HD32, Q9Y340, Q9Y341
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: April 17, 2007
Last modified: August 12, 2020
This is version 200 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again