Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

CACNB2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei549Required for CaMK2D-bindingBy similarity1

GO - Molecular functioni

  • actin filament binding Source: BHF-UCL
  • calcium channel activity Source: UniProtKB
  • voltage-gated calcium channel activity Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

ReactomeiR-HSA-112308 Presynaptic depolarization and calcium channel opening
R-HSA-400042 Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037 NCAM1 interactions
R-HSA-422356 Regulation of insulin secretion
R-HSA-5576892 Phase 0 - rapid depolarisation
R-HSA-5576893 Phase 2 - plateau phase
SignaLinkiQ08289
SIGNORiQ08289

Protein family/group databases

TCDBi8.A.22.1.2 the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Lambert-Eaton myasthenic syndrome antigen B
Short name:
MYSB
Gene namesi
Name:CACNB2
Synonyms:CACNLB2, MYSB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000165995.18
HGNCiHGNC:1402 CACNB2
MIMi600003 gene
neXtProtiNX_Q08289

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Brugada syndrome 4 (BRGDA4)1 Publication
The gene represented in this entry may be involved in disease pathogenesis.
Disease descriptionA heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs, the individual will faint and may die in a few minutes if the heart is not reset.
See also OMIM:611876
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_044041535S → L in BRGDA4; unknown pathological significance; affects channel activity. 1 PublicationCorresponds to variant dbSNP:rs121917812Ensembl.1

Keywords - Diseasei

Brugada syndrome, Disease mutation

Organism-specific databases

DisGeNETi783
GeneReviewsiCACNB2
MalaCardsiCACNB2
MIMi611876 phenotype
OpenTargetsiENSG00000165995
Orphaneti130 Brugada syndrome
PharmGKBiPA88

Chemistry databases

ChEMBLiCHEMBL3317336
DrugBankiDB00381 Amlodipine
DB04855 Dronedarone
DB01023 Felodipine
DB00270 Isradipine
DB00653 Magnesium Sulfate
DB01388 Mibefradil
DB00622 Nicardipine
DB01115 Nifedipine
DB06712 Nilvadipine
DB00393 Nimodipine
DB00401 Nisoldipine
DB01054 Nitrendipine
DB00421 Spironolactone
DB00661 Verapamil

Polymorphism and mutation databases

BioMutaiCACNB2
DMDMi145559447

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440511 – 660Voltage-dependent L-type calcium channel subunit beta-2Add BLAST660

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei204PhosphoserineBy similarity1
Modified residuei207PhosphoserineBy similarity1
Modified residuei218PhosphoserineBy similarity1
Modified residuei550PhosphoserineBy similarity1
Modified residuei554Phosphothreonine; by CaMK2DBy similarity1

Post-translational modificationi

Regulated through phosphorylation at Thr-554 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ08289
PaxDbiQ08289
PeptideAtlasiQ08289
PRIDEiQ08289
ProteomicsDBi58586
58587 [Q08289-2]
58588 [Q08289-3]
58589 [Q08289-4]
58590 [Q08289-5]
58591 [Q08289-6]
58592 [Q08289-7]
58593 [Q08289-8]

PTM databases

iPTMnetiQ08289
PhosphoSitePlusiQ08289

Expressioni

Tissue specificityi

Expressed in all tissues.

Gene expression databases

BgeeiENSG00000165995 Expressed in 178 organ(s), highest expression level in heart
ExpressionAtlasiQ08289 baseline and differential
GenevisibleiQ08289 HS

Organism-specific databases

HPAiHPA035325
HPA035326

Interactioni

Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and CACNA2D1. The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio, i.e. it contains either CACNB1 or CACNB2. Interacts with CACNA1C (By similarity). Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane (PubMed:17525370). Interacts with TMIGD2 (PubMed:22419821). Interacts with CAMK2D. Interacts with CBARP (By similarity). Interacts with CAMK2A (PubMed:28130356).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CACNA1CQ139364EBI-15707999,EBI-1038838

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107237, 3 interactors
ComplexPortaliCPX-3195 Cardiac muscle VGCC complex
IntActiQ08289, 5 interactors
STRINGi9606.ENSP00000320025

Structurei

3D structure databases

ProteinModelPortaliQ08289
SMRiQ08289
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini114 – 183SH3PROSITE-ProRule annotationAdd BLAST70

Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
GeneTreeiENSGT00390000002740
HOGENOMiHOG000230979
HOVERGENiHBG050765
InParanoidiQ08289
KOiK04863
OMAiNRDVYIR
OrthoDBiEOG091G09C1
PhylomeDBiQ08289
TreeFamiTF316195

Family and domain databases

CDDicd12040 SH3_CACNB2, 1 hit
InterProiView protein in InterPro
IPR035605 CACNB2_SH3
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005444 VDCC_L_b2su
IPR000584 VDCC_L_bsu
PANTHERiPTHR11824 PTHR11824, 1 hit
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
PR01628 LCACHANNELB2
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 2 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

Sequences (10+)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 9 potential isoforms that are computationally mapped.iShow all

Isoform 2d (identifier: Q08289-1) [UniParc]FASTAAdd to basket
Also known as: CACNB2d

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQRDMSKSP PTAAAAVAQE IQMELLENVA PAGALGAAAQ SYGKGARRKN
60 70 80 90 100
RFKGSDGSTS SDTTSNSFVR QGSADSYTSR PSDSDVSLEE DREAVRREAE
110 120 130 140 150
RQAQAQLEKA KTKPVAFAVR TNVSYSAAHE DDVPVPGMAI SFEAKDFLHV
160 170 180 190 200
KEKFNNDWWI GRLVKEGCEI GFIPSPVKLE NMRLQHEQRA KQGKFYSSKS
210 220 230 240 250
GGNSSSSLGD IVPSSRKSTP PSSAIDIDAT GLDAEENDIP ANHRSPKPSA
260 270 280 290 300
NSVTSPHSKE KRMPFFKKTE HTPPYDVVPS MRPVVLVGPS LKGYEVTDMM
310 320 330 340 350
QKALFDFLKH RFEGRISITR VTADISLAKR SVLNNPSKHA IIERSNTRSS
360 370 380 390 400
LAEVQSEIER IFELARTLQL VVLDADTINH PAQLSKTSLA PIIVYVKISS
410 420 430 440 450
PKVLQRLIKS RGKSQAKHLN VQMVAADKLA QCPPELFDVI LDENQLEDAC
460 470 480 490 500
EHLADYLEAY WKATHPPSSS LPNPLLSRTL ATSSLPLSPT LASNSQGSQG
510 520 530 540 550
DQRTDRSAPI RSASQAEEEP SVEPVKKSQH RSSSSAPHHN HRSGTSRGLS
560 570 580 590 600
RQETFDSETQ ESRDSAYVEP KEDYSHDHVD HYASHRDHNH RDETHGSSDH
610 620 630 640 650
RHRESRHRSR DVDREQDHNE CNKQRSRHKS KDRYCEKDGE VISKKRNEAG
660
EWNRDVYIRQ
Length:660
Mass (Da):73,581
Last modified:April 17, 2007 - v3
Checksum:i4A08B141EE66404E
GO
Isoform 2a (identifier: Q08289-2) [UniParc]FASTAAdd to basket
Also known as: CACNB2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY

Show »
Length:605
Mass (Da):68,142
Checksum:i710A5E734B7442DD
GO
Isoform 2b (identifier: Q08289-3) [UniParc]FASTAAdd to basket
Also known as: CACNB2b, 2aN4

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG

Show »
Length:606
Mass (Da):68,164
Checksum:iF4A4A1BAE6A105F0
GO
Isoform 2c (identifier: Q08289-4) [UniParc]FASTAAdd to basket
Also known as: CACNB2c, 2aN2

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI

Show »
Length:632
Mass (Da):70,832
Checksum:iFBD00FB30E47E5FB
GO
Isoform 2e (identifier: Q08289-5) [UniParc]FASTAAdd to basket
Also known as: CACNB2e

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKNSDIC

Show »
Length:612
Mass (Da):68,838
Checksum:i1D60077179676927
GO
Isoform 2f (identifier: Q08289-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS

Show »
Length:567
Mass (Da):64,010
Checksum:iCBCD97B7822B92E6
GO
Isoform 2g (identifier: Q08289-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS

Show »
Length:622
Mass (Da):69,449
Checksum:i9FBABEC5BE5DD074
GO
Isoform 2h (identifier: Q08289-8) [UniParc]FASTAAdd to basket
Also known as: 2cN1

The sequence of this isoform differs from the canonical sequence as follows:
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Show »
Length:636
Mass (Da):71,075
Checksum:i71521EDDD736A9CF
GO
Isoform 2cN2 (identifier: Q08289-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Show »
Length:608
Mass (Da):68,326
Checksum:i45DCA4A5AF7ACAF4
GO
Isoform 2cN4 (identifier: Q08289-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Show »
Length:582
Mass (Da):65,658
Checksum:i4AC64252EDD46ABB
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6TME0Q6TME0_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
176Annotation score:
A6PVM6A6PVM6_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
410Annotation score:
A0A087WVX5A0A087WVX5_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
581Annotation score:
A0A087WWJ0A0A087WWJ0_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
355Annotation score:
A0A087WUH4A0A087WUH4_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
164Annotation score:
A0A2R8YFX9A0A2R8YFX9_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
240Annotation score:
A0A2R8Y555A0A2R8Y555_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
576Annotation score:
A0A2R8Y7A6A0A2R8Y7A6_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
214Annotation score:
A0A2U3TZM7A0A2U3TZM7_HUMAN
Voltage-dependent L-type calcium ch...
CACNB2
574Annotation score:

Sequence cautioni

The sequence AAB51370 differs from that shown. Reason: Frameshift at position 515.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti56D → N in AAQ97608 (PubMed:14762176).Curated1
Sequence conflicti69V → L in AAD33729 (Ref. 5) Curated1
Sequence conflicti100 – 101ER → Q in AAD33729 (Ref. 5) Curated2
Sequence conflicti122N → D in AAD33729 (Ref. 5) Curated1
Sequence conflicti364L → V in AAD33729 (Ref. 5) Curated1
Sequence conflicti364L → V in AAD33730 (Ref. 5) Curated1
Sequence conflicti406R → T in AAD33729 (Ref. 5) Curated1
Sequence conflicti406R → T in AAD33730 (Ref. 5) Curated1
Sequence conflicti501D → H in AAD33729 (Ref. 5) Curated1
Sequence conflicti501D → H in AAD33730 (Ref. 5) Curated1
Sequence conflicti524P → G in AAD33729 (Ref. 5) Curated1
Sequence conflicti524P → G in AAD33730 (Ref. 5) Curated1
Sequence conflicti624Q → QQ in AAD33729 (Ref. 5) Curated1
Sequence conflicti624Q → QQ in AAD33730 (Ref. 5) Curated1
Sequence conflicti659R → P in AAB53332 (PubMed:9254841).Curated1
Sequence conflicti659R → P in AAG01473 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAL16948 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAL16951 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAL16950 (PubMed:12042350).Curated1
Sequence conflicti659R → P in AAQ97606 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97607 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97608 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97609 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAQ97610 (PubMed:14762176).Curated1
Sequence conflicti659R → P in AAL73495 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03635099A → G in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs745502425Ensembl.1
Natural variantiVAR_044041535S → L in BRGDA4; unknown pathological significance; affects channel activity. 1 PublicationCorresponds to variant dbSNP:rs121917812Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0006271 – 71MVQRD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2a and isoform 2f. 5 PublicationsAdd BLAST71
Alternative sequenceiVSP_0006281 – 71MVQRD…SFVRQ → MLDRRLIAPQTKYIIPG in isoform 2b and isoform 2cN4. 2 PublicationsAdd BLAST71
Alternative sequenceiVSP_0006291 – 71MVQRD…SFVRQ → MKATWIRLLKRAKGGRLKNS DIC in isoform 2e. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_0006261 – 40MVQRD…GAAAQ → MNQGSGLDLLKI in isoform 2c and isoform 2cN2. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_000630224 – 268AIDID…PFFKK → AKQKQKS in isoform 2f and isoform 2g. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_000631224 – 268AIDID…PFFKK → GAKSADEQDQWKTAGLFWRF T in isoform 2h, isoform 2cN2 and isoform 2cN4. 2 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S60415 mRNA Translation: AAB51370.1 Frameshift.
U95019 mRNA Translation: AAB53332.1
AF423189 mRNA Translation: AAL16948.1
AF423190 mRNA Translation: AAL16949.1
AF423191 mRNA Translation: AAL16950.1
AF423192 mRNA Translation: AAL16951.1
AF285239 mRNA Translation: AAG01473.2
AY393858 mRNA Translation: AAQ97606.1
AY393859 mRNA Translation: AAQ97607.1
AY393860 mRNA Translation: AAQ97608.1
AY393861 mRNA Translation: AAQ97609.1
AY393862 mRNA Translation: AAQ97610.1
AF137376 mRNA Translation: AAD33729.1
AF137377 mRNA Translation: AAD33730.1
AY027898
, AY027893, AY027894, AY027895, AY027896, AY027897 Genomic DNA Translation: AAK16994.1
AF465485 mRNA Translation: AAL73495.1
AL139814 Genomic DNA No translation available.
AL360231 Genomic DNA No translation available.
AL390783 Genomic DNA No translation available.
AL450364 Genomic DNA No translation available.
AL450384 Genomic DNA No translation available.
AL353603 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86196.1
CH471072 Genomic DNA Translation: EAW86197.1
BC136409 mRNA Translation: AAI36410.1
CCDSiCCDS41493.1 [Q08289-9]
CCDS41494.1 [Q08289-3]
CCDS7125.1 [Q08289-1]
CCDS7126.1 [Q08289-8]
CCDS7127.1 [Q08289-4]
CCDS7128.1 [Q08289-2]
CCDS7129.1 [Q08289-5]
CCDS81442.1 [Q08289-6]
PIRiA48895
RefSeqiNP_000715.2, NM_000724.3 [Q08289-2]
NP_001316989.1, NM_001330060.1 [Q08289-6]
NP_963864.1, NM_201570.2 [Q08289-5]
NP_963865.2, NM_201571.3 [Q08289-4]
NP_963866.2, NM_201572.3 [Q08289-9]
NP_963884.2, NM_201590.2 [Q08289-3]
NP_963887.2, NM_201593.2 [Q08289-7]
NP_963890.2, NM_201596.2 [Q08289-1]
NP_963891.1, NM_201597.2 [Q08289-8]
XP_011517961.1, XM_011519659.2 [Q08289-10]
UniGeneiHs.59093

Genome annotation databases

EnsembliENST00000282343; ENSP00000282343; ENSG00000165995 [Q08289-4]
ENST00000324631; ENSP00000320025; ENSG00000165995 [Q08289-1]
ENST00000352115; ENSP00000344474; ENSG00000165995 [Q08289-8]
ENST00000377315; ENSP00000366532; ENSG00000165995 [Q08289-5]
ENST00000377319; ENSP00000366536; ENSG00000165995 [Q08289-6]
ENST00000377329; ENSP00000366546; ENSG00000165995 [Q08289-3]
ENST00000396576; ENSP00000379821; ENSG00000165995 [Q08289-2]
ENST00000645287; ENSP00000496203; ENSG00000165995 [Q08289-9]
GeneIDi783
KEGGihsa:783
UCSCiuc001ipr.3 human [Q08289-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCACB2_HUMAN
AccessioniPrimary (citable) accession number: Q08289
Secondary accession number(s): A6PVM5
, A6PVM7, A6PVM8, O00304, Q5QJ99, Q5QJA0, Q5VVG9, Q5VVH0, Q5VWV6, Q6TME1, Q6TME2, Q6TME3, Q8WX81, Q96NZ3, Q96NZ4, Q96NZ5, Q9BWU2, Q9HD32, Q9Y340, Q9Y341
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: April 17, 2007
Last modified: September 12, 2018
This is version 186 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again