Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Forkhead box protein M1

Gene

FOXM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi235 – 327Fork-headPROSITE-ProRule annotationAdd BLAST93

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processCell cycle, DNA damage, DNA repair, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156711 Polo-like kinase mediated events
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q08050

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Forkhead box protein M1
Alternative name(s):
Forkhead-related protein FKHL16
Hepatocyte nuclear factor 3 forkhead homolog 11
Short name:
HFH-11
Short name:
HNF-3/fork-head homolog 11
M-phase phosphoprotein 2
MPM-2 reactive phosphoprotein 2
Transcription factor Trident
Winged-helix factor from INS-1 cells
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FOXM1
Synonyms:FKHL16, HFH11, MPP2, WIN
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000111206.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3818 FOXM1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602341 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q08050

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi611T → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-693. 1 Publication1
Mutagenesisi693S → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-611. 1 Publication1
Mutagenesisi730S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-739. 1 Publication1
Mutagenesisi739S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-730. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
2305

Open Targets

More...
OpenTargetsi
ENSG00000111206

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28236

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FOXM1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12644391

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000918631 – 763Forkhead box protein M1Add BLAST763

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki201Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki325Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei331PhosphoserineCombined sources1
Cross-linki356Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei376Phosphoserine; by CHEK21 Publication1
Cross-linki422Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki440Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei522PhosphoserineCombined sources1
Modified residuei611Phosphothreonine; by CDK11 Publication1
Modified residuei620PhosphothreonineCombined sources1
Modified residuei627PhosphothreonineCombined sources1
Modified residuei662PhosphothreonineCurated1
Modified residuei693Phosphoserine; by CDK11 Publication1
Modified residuei730Phosphoserine; by PLK1Combined sources1 Publication1
Modified residuei739Phosphoserine; by PLK1Combined sources1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in M (mitotic) phase. Phosphorylation by the checkpoint kinase CHEK2 in response to DNA damage increases the FOXM1 protein stability probably stimulating the transcription of genes involved in DNA repair. Phosphorylated by CDK1 in late S and G2 phases, creating docking sites for the POLO box domains of PLK1. Subsequently, PLK1 binds and phosphorylates FOXM1, leading to activation of transcriptional activity and subsequent enhanced expression of key mitotic regulators.2 Publications

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q08050

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q08050

PeptideAtlas

More...
PeptideAtlasi
Q08050

PRoteomics IDEntifications database

More...
PRIDEi
Q08050

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58567
58568 [Q08050-2]
58569 [Q08050-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q08050

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q08050

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus.

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Induced during liver regeneration and oxidative stress.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111206 Expressed in 117 organ(s), highest expression level in endometrium epithelium

CleanEx database of gene expression profiles

More...
CleanExi
HS_FOXM1
HS_MPP2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q08050 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q08050 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB017832

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108594, 82 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q08050

Database of interacting proteins

More...
DIPi
DIP-36754N

Protein interaction database and analysis system

More...
IntActi
Q08050, 61 interactors

Molecular INTeraction database

More...
MINTi
Q08050

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342307

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1763
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q08050

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q08050

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q08050

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi480 – 513Glu/Pro/Ser/Thr-richAdd BLAST34

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4.

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2294 Eukaryota
COG5025 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158804

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112633

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051652

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q08050

KEGG Orthology (KO)

More...
KOi
K09406

Identification of Orthologs from Complete Genome Data

More...
OMAi
CGGAPTH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G03GL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q08050

TreeFam database of animal gene trees

More...
TreeFami
TF333250

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00059 FH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001766 Fork_head_dom
IPR018122 TF_fork_head_CS_1
IPR030456 TF_fork_head_CS_2
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00250 Forkhead, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00053 FORKHEAD

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00339 FH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00657 FORK_HEAD_1, 1 hit
PS00658 FORK_HEAD_2, 1 hit
PS50039 FORK_HEAD_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human.

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q08050-1) [UniParc]FASTAAdd to basket
Also known as: FoxM1C, FOXM1-c

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKTSPRRPLI LKRRRLPLPV QNAPSETSEE EPKRSPAQQE SNQAEASKEV
60 70 80 90 100
AESNSCKFPA GIKIINHPTM PNTQVVAIPN NANIHSIITA LTAKGKESGS
110 120 130 140 150
SGPNKFILIS CGGAPTQPPG LRPQTQTSYD AKRTEVTLET LGPKPAARDV
160 170 180 190 200
NLPRPPGALC EQKRETCADG EAAGCTINNS LSNIQWLRKM SSDGLGSRSI
210 220 230 240 250
KQEMEEKENC HLEQRQVKVE EPSRPSASWQ NSVSERPPYS YMAMIQFAIN
260 270 280 290 300
STERKRMTLK DIYTWIEDHF PYFKHIAKPG WKNSIRHNLS LHDMFVRETS
310 320 330 340 350
ANGKVSFWTI HPSANRYLTL DQVFKPLDPG SPQLPEHLES QQKRPNPELR
360 370 380 390 400
RNMTIKTELP LGARRKMKPL LPRVSSYLVP IQFPVNQSLV LQPSVKVPLP
410 420 430 440 450
LAASLMSSEL ARHSKRVRIA PKVLLAEEGI APLSSAGPGK EEKLLFGEGF
460 470 480 490 500
SPLLPVQTIK EEEIQPGEEM PHLARPIKVE SPPLEEWPSP APSFKEESSH
510 520 530 540 550
SWEDSSQSPT PRPKKSYSGL RSPTRCVSEM LVIQHRERRE RSRSRRKQHL
560 570 580 590 600
LPPCVDEPEL LFSEGPSTSR WAAELPFPAD SSDPASQLSY SQEVGGPFKT
610 620 630 640 650
PIKETLPISS TPSKSVLPRT PESWRLTPPA KVGGLDFSPV QTSQGASDPL
660 670 680 690 700
PDPLGLMDLS TTPLQSAPPL ESPQRLLSSE PLDLISVPFG NSSPSDIDVP
710 720 730 740 750
KPGSPEPQVS GLAANRSLTE GLVLDTMNDS LSKILLDISF PGLDEDPLGP
760
DNINWSQFIP ELQ
Length:763
Mass (Da):84,283
Last modified:December 1, 2000 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i963CAC8FE7498E9B
GO
Isoform 2 (identifier: Q08050-2) [UniParc]FASTAAdd to basket
Also known as: FoxM1B, FOXM1-b

The sequence of this isoform differs from the canonical sequence as follows:
     326-340: Missing.

Show »
Length:748
Mass (Da):82,685
Checksum:i3224A22B1434A531
GO
Isoform 4 (identifier: Q08050-3) [UniParc]FASTAAdd to basket
Also known as: FoxM1A, FOXM1-a

The sequence of this isoform differs from the canonical sequence as follows:
     423-423: V → VFGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSV

Show »
Length:801
Mass (Da):88,596
Checksum:i82416A3FA271C5D5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0D9SFF0A0A0D9SFF0_HUMAN
Forkhead box protein M1
FOXM1
748Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG99H0YG99_HUMAN
Forkhead box protein M1
FOXM1
206Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGS4H0YGS4_HUMAN
Forkhead box protein M1
FOXM1
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti3T → A in AAC63595 (PubMed:9242644).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_025239402A → E1 PublicationCorresponds to variant dbSNP:rs28990715Ensembl.1
Natural variantiVAR_025240450F → L1 PublicationCorresponds to variant dbSNP:rs28919868Ensembl.1
Natural variantiVAR_020024643S → P2 PublicationsCorresponds to variant dbSNP:rs3742076Ensembl.1
Natural variantiVAR_025241669P → R1 PublicationCorresponds to variant dbSNP:rs28919869Ensembl.1
Natural variantiVAR_025242673P → L1 PublicationCorresponds to variant dbSNP:rs28919870Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001547326 – 340Missing in isoform 2. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_001548423V → VFGEQVVFGYMSKFFSGDLR DFGTPITSLFNFIFLCLSV in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U74612 mRNA Translation: AAC51128.1
U74613 mRNA Translation: AAC51129.1
U83113 mRNA Translation: AAC63595.1
DQ022289 Genomic DNA Translation: AAY26401.1
BC006192 mRNA Translation: AAH06192.1
BC006529 mRNA Translation: AAH06529.1
BC012863 mRNA Translation: AAH12863.1
L16783 mRNA Translation: AAC37541.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8515.1 [Q08050-1]
CCDS8516.1 [Q08050-3]
CCDS8517.1 [Q08050-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
B36881

NCBI Reference Sequences

More...
RefSeqi
NP_001230017.1, NM_001243088.1
NP_001230018.1, NM_001243089.1
NP_068772.2, NM_021953.3 [Q08050-1]
NP_973731.1, NM_202002.2 [Q08050-3]
NP_973732.1, NM_202003.2 [Q08050-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.239
Hs.735243

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000342628; ENSP00000342307; ENSG00000111206 [Q08050-3]
ENST00000359843; ENSP00000352901; ENSG00000111206 [Q08050-1]
ENST00000361953; ENSP00000354492; ENSG00000111206 [Q08050-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2305

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2305

UCSC genome browser

More...
UCSCi
uc001qle.4 human [Q08050-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U74612 mRNA Translation: AAC51128.1
U74613 mRNA Translation: AAC51129.1
U83113 mRNA Translation: AAC63595.1
DQ022289 Genomic DNA Translation: AAY26401.1
BC006192 mRNA Translation: AAH06192.1
BC006529 mRNA Translation: AAH06529.1
BC012863 mRNA Translation: AAH12863.1
L16783 mRNA Translation: AAC37541.1
CCDSiCCDS8515.1 [Q08050-1]
CCDS8516.1 [Q08050-3]
CCDS8517.1 [Q08050-2]
PIRiB36881
RefSeqiNP_001230017.1, NM_001243088.1
NP_001230018.1, NM_001243089.1
NP_068772.2, NM_021953.3 [Q08050-1]
NP_973731.1, NM_202002.2 [Q08050-3]
NP_973732.1, NM_202003.2 [Q08050-2]
UniGeneiHs.239
Hs.735243

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3G73X-ray2.21A/B222-360[»]
ProteinModelPortaliQ08050
SMRiQ08050
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108594, 82 interactors
CORUMiQ08050
DIPiDIP-36754N
IntActiQ08050, 61 interactors
MINTiQ08050
STRINGi9606.ENSP00000342307

PTM databases

iPTMnetiQ08050
PhosphoSitePlusiQ08050

Polymorphism and mutation databases

BioMutaiFOXM1
DMDMi12644391

Proteomic databases

EPDiQ08050
PaxDbiQ08050
PeptideAtlasiQ08050
PRIDEiQ08050
ProteomicsDBi58567
58568 [Q08050-2]
58569 [Q08050-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2305
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342628; ENSP00000342307; ENSG00000111206 [Q08050-3]
ENST00000359843; ENSP00000352901; ENSG00000111206 [Q08050-1]
ENST00000361953; ENSP00000354492; ENSG00000111206 [Q08050-2]
GeneIDi2305
KEGGihsa:2305
UCSCiuc001qle.4 human [Q08050-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2305
DisGeNETi2305
EuPathDBiHostDB:ENSG00000111206.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FOXM1
HGNCiHGNC:3818 FOXM1
HPAiCAB017832
MIMi602341 gene
neXtProtiNX_Q08050
OpenTargetsiENSG00000111206
PharmGKBiPA28236

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2294 Eukaryota
COG5025 LUCA
GeneTreeiENSGT00940000158804
HOGENOMiHOG000112633
HOVERGENiHBG051652
InParanoidiQ08050
KOiK09406
OMAiCGGAPTH
OrthoDBiEOG091G03GL
PhylomeDBiQ08050
TreeFamiTF333250

Enzyme and pathway databases

ReactomeiR-HSA-156711 Polo-like kinase mediated events
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
SIGNORiQ08050

Miscellaneous databases

EvolutionaryTraceiQ08050

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FOXM1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2305

Protein Ontology

More...
PROi
PR:Q08050

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111206 Expressed in 117 organ(s), highest expression level in endometrium epithelium
CleanExiHS_FOXM1
HS_MPP2
ExpressionAtlasiQ08050 baseline and differential
GenevisibleiQ08050 HS

Family and domain databases

CDDicd00059 FH, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR001766 Fork_head_dom
IPR018122 TF_fork_head_CS_1
IPR030456 TF_fork_head_CS_2
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00250 Forkhead, 1 hit
PRINTSiPR00053 FORKHEAD
SMARTiView protein in SMART
SM00339 FH, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS00657 FORK_HEAD_1, 1 hit
PS00658 FORK_HEAD_2, 1 hit
PS50039 FORK_HEAD_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFOXM1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q08050
Secondary accession number(s): O43258
, O43259, O43260, Q4ZGG7, Q9BRL2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 1, 2000
Last modified: December 5, 2018
This is version 197 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again