Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 192 (08 May 2019)
Sequence version 2 (10 Feb 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Kinesin light chain 1

Gene

KLC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.

Caution

It is uncertain whether Met-1 or Met-5 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • microtubule motor activity Source: InterPro
  • motor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
Biological processHost-virus interaction

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5625970 RHO GTPases activate KTN1
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q07866

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin light chain 1
Short name:
KLC 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLC1
Synonyms:KLC, KNS2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6387 KLC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600025 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q07866

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi521S → A or D: No effect on motor function; when associated with A/D-524. 1 Publication1
Mutagenesisi524S → A or D: No effect on motor function; when associated with A/D-521. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
3831

Open Targets

More...
OpenTargetsi
ENSG00000126214

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162393424

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KLC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
223590110

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002150921 – 573Kinesin light chain 1Add BLAST573

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei162PhosphoserineBy similarity1
Modified residuei449PhosphotyrosineBy similarity1
Modified residuei460PhosphoserineBy similarity1
Modified residuei521Phosphoserine; by AMPK1 Publication1
Modified residuei524Phosphoserine; by AMPK1 Publication1
Isoform P (identifier: Q07866-7)
Modified residuei547PhosphoserineCombined sources1
Modified residuei578PhosphoserineCombined sources1
Isoform N (identifier: Q07866-6)
Modified residuei591PhosphoserineCombined sourcesCurated1
Modified residuei622PhosphoserineCombined sourcesCurated1
Isoform J (identifier: Q07866-4)
Modified residuei600PhosphoserineCombined sourcesCurated1
Modified residuei631PhosphoserineCombined sourcesCurated1
Isoform I (identifier: Q07866-9)
Modified residuei600PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q07866

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q07866

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q07866

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q07866

PeptideAtlas

More...
PeptideAtlasi
Q07866

PRoteomics IDEntifications database

More...
PRIDEi
Q07866

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58544
58545 [Q07866-2]
58546 [Q07866-3]
58547 [Q07866-4]
58548 [Q07866-5]
58549 [Q07866-6]
58550 [Q07866-7]
58551 [Q07866-8]
58552 [Q07866-9]

2D gel databases

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
Q07866

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q07866

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q07866

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q07866

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in a variety of tissues. Mostly abundant in brain and spine.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000126214 Expressed in 231 organ(s), highest expression level in cerebellar hemisphere

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q07866 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q07866 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009798
HPA044617
HPA052450

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Oligomeric complex composed of two heavy chains and two light chains. Interacts with SPAG9. Interacts with ATCAY; may link mitochondria to KLC1 and regulate mitochondria localization into neuron projections (By similarity). Interacts (via TPR repeats) with TOR1A; the interaction associates TOR1A with the kinesin oligomeric complex (PubMed:14970196). Interacts with BORCS5 (PubMed:25898167). Interacts with MAPK8IP3/JIP3 and NTRK2/TRKB; interaction with NTRK2/TRKB is mediated by MAPK8IP3/JIP3 (By similarity).By similarity2 Publications
(Microbial infection) Interacts with adenovirus hexon-interlacing protein; this interaction leads to capsid disruption at the nuclear pore complex during virus entry into host cell.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110029, 84 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q07866

Database of interacting proteins

More...
DIPi
DIP-40371N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q07866

Protein interaction database and analysis system

More...
IntActi
Q07866, 43 interactors

Molecular INTeraction database

More...
MINTi
Q07866

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000414982

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1573
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q07866

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati213 – 246TPR 1Add BLAST34
Repeati255 – 288TPR 2Add BLAST34
Repeati297 – 330TPR 3Add BLAST34
Repeati339 – 372TPR 4Add BLAST34
Repeati381 – 414TPR 5Add BLAST34
Repeati464 – 497TPR 6Add BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili27 – 156Add BLAST130

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the kinesin light chain family.Curated

Keywords - Domaini

Coiled coil, Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1840 Eukaryota
COG0457 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155555

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261663

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q07866

KEGG Orthology (KO)

More...
KOi
K10407

Identification of Orthologs from Complete Genome Data

More...
OMAi
EQDDTCE

Database of Orthologous Groups

More...
OrthoDBi
511880at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q07866

TreeFam database of animal gene trees

More...
TreeFami
TF314010

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002151 Kinesin_light
IPR015792 Kinesin_light_repeat
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13176 TPR_7, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00381 KINESINLIGHT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00028 TPR, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01160 KINESIN_LIGHT, 4 hits
PS50005 TPR, 6 hits
PS50293 TPR_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Has the potential to produce 285'919 splice forms.

This entry has 10 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q07866-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYDNMSTMVY IKEDKLEKLT QDEIISKTKQ VIQGLEALKN EHNSILQSLL
60 70 80 90 100
ETLKCLKKDD ESNLVEEKSN MIRKSLEMLE LGLSEAQVMM ALSNHLNAVE
110 120 130 140 150
SEKQKLRAQV RRLCQENQWL RDELANTQQK LQKSEQSVAQ LEEEKKHLEF
160 170 180 190 200
MNQLKKYDDD ISPSEDKDTD STKEPLDDLF PNDEDDPGQG IQQQHSSAAA
210 220 230 240 250
AAQQGGYEIP ARLRTLHNLV IQYASQGRYE VAVPLCKQAL EDLEKTSGHD
260 270 280 290 300
HPDVATMLNI LALVYRDQNK YKDAANLLND ALAIREKTLG KDHPAVAATL
310 320 330 340 350
NNLAVLYGKR GKYKEAEPLC KRALEIREKV LGKDHPDVAK QLNNLALLCQ
360 370 380 390 400
NQGKYEEVEY YYQRALEIYQ TKLGPDDPNV AKTKNNLASC YLKQGKFKQA
410 420 430 440 450
ETLYKEILTR AHEREFGSVD DENKPIWMHA EEREECKGKQ KDGTSFGEYG
460 470 480 490 500
GWYKACKVDS PTVTTTLKNL GALYRRQGKF EAAETLEEAA MRSRKQGLDN
510 520 530 540 550
VHKQRVAEVL NDPENMEKRR SRESLNVDVV KYESGPDGGE EVSMSVEWNG
560 570
GVSGRASFCG KRQQQQWPGR RHR
Length:573
Mass (Da):65,310
Last modified:February 10, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA66E3915C57C2764
GO
Isoform C (identifier: Q07866-2) [UniParc]FASTAAdd to basket
Also known as: KLC1C, R, KLC1R

The sequence of this isoform differs from the canonical sequence as follows:
     551-573: GVSGRASFCGKRQQQQWPGRRHR → MRKMKLGLVN

Show »
Length:560
Mass (Da):63,816
Checksum:iFF62962AF112575C
GO
Isoform G (identifier: Q07866-3) [UniParc]FASTAAdd to basket
Also known as: KLC1G

The sequence of this isoform differs from the canonical sequence as follows:
     542-550: Missing.

Show »
Length:564
Mass (Da):64,319
Checksum:i6576A4BCFC138FA6
GO
Isoform J (identifier: Q07866-4) [UniParc]FASTAAdd to basket
Also known as: KLC1J

The sequence of this isoform differs from the canonical sequence as follows:
     551-551: G → DGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPG
     552-573: VSGRASFCGKRQQQQWPGRRHR → MKRASSLNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH

Show »
Length:637
Mass (Da):71,996
Checksum:iDCCD9D3E561F7A23
GO
Isoform K (identifier: Q07866-5) [UniParc]FASTAAdd to basket
Also known as: KLC1K

The sequence of this isoform differs from the canonical sequence as follows:
     551-551: G → DGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPG

Show »
Length:616
Mass (Da):69,967
Checksum:i40C895F6BAC6EC56
GO
Isoform N (identifier: Q07866-6) [UniParc]FASTAAdd to basket
Also known as: KLC1N

The sequence of this isoform differs from the canonical sequence as follows:
     542-550: Missing.
     551-551: G → DGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPG
     552-573: VSGRASFCGKRQQQQWPGRRHR → MKRASSLNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH

Show »
Length:628
Mass (Da):71,006
Checksum:iDA665C9E7DCC89D9
GO
Isoform P (identifier: Q07866-7) [UniParc]FASTAAdd to basket
Also known as: KLC1P

The sequence of this isoform differs from the canonical sequence as follows:
     542-573: VSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR → MKRASSLNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH

Show »
Length:584
Mass (Da):66,292
Checksum:i7E92734C1FB43CDA
GO
Isoform S (identifier: Q07866-8) [UniParc]FASTAAdd to basket
Also known as: KLC1S, Q, KLC1Q

The sequence of this isoform differs from the canonical sequence as follows:
     542-550: Missing.
     551-573: GVSGRASFCGKRQQQQWPGRRHR → MRKMKLGLVN

Show »
Length:551
Mass (Da):62,826
Checksum:i8754DC7FBB75E8C3
GO
Isoform I (identifier: Q07866-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     550-550: G → GDGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPGMKRASSLNVLNVGGKAAEDRFQ

Show »
Length:639
Mass (Da):72,398
Checksum:i5EA25AF4C9ECDFFC
GO
Isoform D (identifier: Q07866-10) [UniParc]FASTAAdd to basket
Also known as: KLC1D

The sequence of this isoform differs from the canonical sequence as follows:
     551-573: GVSGRASFCGKRQQQQWPGRRHR → DGTGSLKRSG...SSGLEDATAN

Show »
Length:618
Mass (Da):69,765
Checksum:i18C502E6C345E222
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W6L3F8W6L3_HUMAN
Kinesin light chain 1
KLC1
576Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V5R9G3V5R9_HUMAN
Kinesin light chain 1
KLC1
630Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E9S8G5E9S8_HUMAN
Kinesin light chain 1
KLC1
549Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3H3G3V3H3_HUMAN
Kinesin light chain 1
KLC1
609Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2E7G3V2E7_HUMAN
Kinesin light chain 1
KLC1
551Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG16H0YG16_HUMAN
Kinesin light chain 1
KLC1
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2P7G3V2P7_HUMAN
Kinesin light chain 1
KLC1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJU9H0YJU9_HUMAN
Kinesin light chain 1
KLC1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJT3H0YJT3_HUMAN
Kinesin light chain 1
KLC1
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJL0H0YJL0_HUMAN
Kinesin light chain 1
KLC1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA16576 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAF72543 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAO62549 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence DAA01265 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01266 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01268 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01289 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01291 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01292 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01295 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01296 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA01297 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4N → T in AAA16576 (PubMed:8274221).Curated1
Sequence conflicti4N → T in AAO62548 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62549 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62550 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62551 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62553 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62552 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62554 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO62555 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAO64641 (PubMed:12839500).Curated1
Sequence conflicti4N → T in AAF72543 (Ref. 3) Curated1
Isoform N (identifier: Q07866-6)
Sequence conflicti622S → T in AAO62551 (PubMed:12839500).Combined sourcesCurated1
Isoform J (identifier: Q07866-4)
Sequence conflicti631S → T in AAO62555 (PubMed:12839500).Combined sourcesCurated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_008021542 – 573VSMSV…GRRHR → MKRASSLNVLNVGGKAAEDR FQERNNCLADSRALSASHTD LAH in isoform P. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_008017542 – 550Missing in isoform G, isoform N and isoform S. 1 Publication9
Alternative sequenceiVSP_023323550G → GDGTGSLKRSGSFSKLRASI RRSSEKLVRKLKGGSSRESE PKNPGMKRASSLNVLNVGGK AAEDRFQ in isoform I. 1 Publication1
Alternative sequenceiVSP_008018551 – 573GVSGR…GRRHR → MRKMKLGLVN in isoform C and isoform S. 2 PublicationsAdd BLAST23
Alternative sequenceiVSP_046424551 – 573GVSGR…GRRHR → DGTGSLKRSGSFSKLRASIR RSSEKLVRKLKGGSSRESEP KNPGASLAEPLFVENDSSSS GLEDATAN in isoform D. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_008019551G → DGTGSLKRSGSFSKLRASIR RSSEKLVRKLKGGSSRESEP KNPG in isoform J, isoform K and isoform N. 1 Publication1
Alternative sequenceiVSP_008020552 – 573VSGRA…GRRHR → MKRASSLNVLNVGGKAAEDR FQERNNCLADSRALSASHTD LAH in isoform J and isoform N. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L04733 mRNA Translation: AAA16576.1 Different initiation.
AY180163 mRNA Translation: AAO62548.1
AY180164 mRNA Translation: AAO62549.1 Different initiation.
AY180165 mRNA Translation: AAO62550.1
AY180166 mRNA Translation: AAO62551.1
AY180168 mRNA Translation: AAO62553.1
AY180167 mRNA Translation: AAO62552.1
AY180169 mRNA Translation: AAO62554.1
AY180170 mRNA Translation: AAO62555.1
AY244715 mRNA Translation: AAO64641.1
AF267530
, AF267518, AF267519, AF267520, AF267521, AF267522, AF267523, AF267524, AF267525, AF267526, AF267527, AF267528, AF267529 Genomic DNA Translation: AAF72543.1 Different initiation.
AL049840 Genomic DNA No translation available.
AL139300 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81834.1
BC008881 mRNA Translation: AAH08881.1
BK000681 mRNA Translation: DAA01265.1 Different initiation.
BK000682 mRNA Translation: DAA01266.1 Different initiation.
BK000684 mRNA Translation: DAA01268.1 Different initiation.
BK001163 mRNA Translation: DAA01289.1 Different initiation.
BK001165 mRNA Translation: DAA01291.1 Different initiation.
BK001166 mRNA Translation: DAA01292.1 Different initiation.
BK001169 mRNA Translation: DAA01295.1 Different initiation.
BK001170 mRNA Translation: DAA01296.1 Different initiation.
BK001171 mRNA Translation: DAA01297.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32165.1 [Q07866-2]
CCDS41996.1 [Q07866-1]
CCDS45168.1 [Q07866-10]

Protein sequence database of the Protein Information Resource

More...
PIRi
I53013

NCBI Reference Sequences

More...
RefSeqi
NP_001123579.1, NM_001130107.1 [Q07866-10]
NP_005543.2, NM_005552.4 [Q07866-2]
NP_891553.2, NM_182923.3 [Q07866-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000246489; ENSP00000246489; ENSG00000126214 [Q07866-4]
ENST00000334553; ENSP00000334523; ENSG00000126214 [Q07866-9]
ENST00000347839; ENSP00000334618; ENSG00000126214 [Q07866-6]
ENST00000348520; ENSP00000341154; ENSG00000126214 [Q07866-1]
ENST00000389744; ENSP00000374394; ENSG00000126214 [Q07866-2]
ENST00000452929; ENSP00000414982; ENSG00000126214 [Q07866-10]
ENST00000553286; ENSP00000452487; ENSG00000126214 [Q07866-2]
ENST00000554228; ENSP00000450616; ENSG00000126214 [Q07866-2]
ENST00000557450; ENSP00000450648; ENSG00000126214 [Q07866-3]
ENST00000634686; ENSP00000488938; ENSG00000126214 [Q07866-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3831

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3831

UCSC genome browser

More...
UCSCi
uc001ynm.2 human [Q07866-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04733 mRNA Translation: AAA16576.1 Different initiation.
AY180163 mRNA Translation: AAO62548.1
AY180164 mRNA Translation: AAO62549.1 Different initiation.
AY180165 mRNA Translation: AAO62550.1
AY180166 mRNA Translation: AAO62551.1
AY180168 mRNA Translation: AAO62553.1
AY180167 mRNA Translation: AAO62552.1
AY180169 mRNA Translation: AAO62554.1
AY180170 mRNA Translation: AAO62555.1
AY244715 mRNA Translation: AAO64641.1
AF267530
, AF267518, AF267519, AF267520, AF267521, AF267522, AF267523, AF267524, AF267525, AF267526, AF267527, AF267528, AF267529 Genomic DNA Translation: AAF72543.1 Different initiation.
AL049840 Genomic DNA No translation available.
AL139300 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81834.1
BC008881 mRNA Translation: AAH08881.1
BK000681 mRNA Translation: DAA01265.1 Different initiation.
BK000682 mRNA Translation: DAA01266.1 Different initiation.
BK000684 mRNA Translation: DAA01268.1 Different initiation.
BK001163 mRNA Translation: DAA01289.1 Different initiation.
BK001165 mRNA Translation: DAA01291.1 Different initiation.
BK001166 mRNA Translation: DAA01292.1 Different initiation.
BK001169 mRNA Translation: DAA01295.1 Different initiation.
BK001170 mRNA Translation: DAA01296.1 Different initiation.
BK001171 mRNA Translation: DAA01297.1 Different initiation.
CCDSiCCDS32165.1 [Q07866-2]
CCDS41996.1 [Q07866-1]
CCDS45168.1 [Q07866-10]
PIRiI53013
RefSeqiNP_001123579.1, NM_001130107.1 [Q07866-10]
NP_005543.2, NM_005552.4 [Q07866-2]
NP_891553.2, NM_182923.3 [Q07866-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NF1X-ray2.80A203-497[»]
5OJ8X-ray2.25A185-418[»]
SMRiQ07866
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110029, 84 interactors
CORUMiQ07866
DIPiDIP-40371N
ELMiQ07866
IntActiQ07866, 43 interactors
MINTiQ07866
STRINGi9606.ENSP00000414982

PTM databases

iPTMnetiQ07866
PhosphoSitePlusiQ07866
SwissPalmiQ07866

Polymorphism and mutation databases

BioMutaiKLC1
DMDMi223590110

2D gel databases

UCD-2DPAGEiQ07866

Proteomic databases

EPDiQ07866
jPOSTiQ07866
MaxQBiQ07866
PaxDbiQ07866
PeptideAtlasiQ07866
PRIDEiQ07866
ProteomicsDBi58544
58545 [Q07866-2]
58546 [Q07866-3]
58547 [Q07866-4]
58548 [Q07866-5]
58549 [Q07866-6]
58550 [Q07866-7]
58551 [Q07866-8]
58552 [Q07866-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3831
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000246489; ENSP00000246489; ENSG00000126214 [Q07866-4]
ENST00000334553; ENSP00000334523; ENSG00000126214 [Q07866-9]
ENST00000347839; ENSP00000334618; ENSG00000126214 [Q07866-6]
ENST00000348520; ENSP00000341154; ENSG00000126214 [Q07866-1]
ENST00000389744; ENSP00000374394; ENSG00000126214 [Q07866-2]
ENST00000452929; ENSP00000414982; ENSG00000126214 [Q07866-10]
ENST00000553286; ENSP00000452487; ENSG00000126214 [Q07866-2]
ENST00000554228; ENSP00000450616; ENSG00000126214 [Q07866-2]
ENST00000557450; ENSP00000450648; ENSG00000126214 [Q07866-3]
ENST00000634686; ENSP00000488938; ENSG00000126214 [Q07866-7]
GeneIDi3831
KEGGihsa:3831
UCSCiuc001ynm.2 human [Q07866-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3831
DisGeNETi3831

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KLC1
HGNCiHGNC:6387 KLC1
HPAiCAB009798
HPA044617
HPA052450
MIMi600025 gene
neXtProtiNX_Q07866
OpenTargetsiENSG00000126214
PharmGKBiPA162393424

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1840 Eukaryota
COG0457 LUCA
GeneTreeiENSGT00940000155555
HOGENOMiHOG000261663
InParanoidiQ07866
KOiK10407
OMAiEQDDTCE
OrthoDBi511880at2759
PhylomeDBiQ07866
TreeFamiTF314010

Enzyme and pathway databases

ReactomeiR-HSA-2132295 MHC class II antigen presentation
R-HSA-5625970 RHO GTPases activate KTN1
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SIGNORiQ07866

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KLC1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KLC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3831

Protein Ontology

More...
PROi
PR:Q07866

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000126214 Expressed in 231 organ(s), highest expression level in cerebellar hemisphere
ExpressionAtlasiQ07866 baseline and differential
GenevisibleiQ07866 HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR002151 Kinesin_light
IPR015792 Kinesin_light_repeat
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF13176 TPR_7, 1 hit
PRINTSiPR00381 KINESINLIGHT
SMARTiView protein in SMART
SM00028 TPR, 5 hits
SUPFAMiSSF48452 SSF48452, 2 hits
PROSITEiView protein in PROSITE
PS01160 KINESIN_LIGHT, 4 hits
PS50005 TPR, 6 hits
PS50293 TPR_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q07866
Secondary accession number(s): A6NF62
, F8VTM4, Q7RTM2, Q7RTM3, Q7RTM5, Q7RTP9, Q7RTQ3, Q7RTQ5, Q7RTQ6, Q86SF5, Q86TF5, Q86V74, Q86V75, Q86V76, Q86V77, Q86V78, Q86V79, Q96H62
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: February 10, 2009
Last modified: May 8, 2019
This is version 192 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again