The new UniProt website is here!
Take me to UniProt BETA
UniProtKB - Q07812 (BAX_HUMAN)
Protein
Apoptosis regulator BAX
Gene
BAX
Organism
Homo sapiens (Human)
Status
Functioni
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670).
Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
8 PublicationsGO - Molecular functioni
- BH3 domain binding Source: UniProtKB
- channel activity Source: BHF-UCL
- chaperone binding Source: Ensembl
- Hsp70 protein binding Source: Ensembl
- identical protein binding Source: UniProtKB
- lipid binding Source: HGNC-UCL
- protein heterodimerization activity Source: HGNC-UCL
- protein homodimerization activity Source: HGNC-UCL
GO - Biological processi
- activation of cysteine-type endopeptidase activity involved in apoptotic process Source: HGNC-UCL
- activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c Source: HGNC-UCL
- activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway Source: Ensembl
- apoptotic mitochondrial changes Source: HGNC-UCL
- apoptotic process Source: DIBU
- apoptotic process involved in blood vessel morphogenesis Source: Ensembl
- apoptotic process involved in embryonic digit morphogenesis Source: Ensembl
- apoptotic signaling pathway Source: HGNC-UCL
- B cell apoptotic process Source: HGNC-UCL
- B cell homeostasis Source: Ensembl
- B cell homeostatic proliferation Source: Ensembl
- B cell negative selection Source: Ensembl
- B cell receptor apoptotic signaling pathway Source: BHF-UCL
- blood vessel remodeling Source: Ensembl
- cellular response to unfolded protein Source: ParkinsonsUK-UCL
- cellular response to UV Source: Ensembl
- cellular response to virus Source: UniProtKB
- cerebral cortex development Source: Ensembl
- development of secondary sexual characteristics Source: Ensembl
- ectopic germ cell programmed cell death Source: Ensembl
- endoplasmic reticulum calcium ion homeostasis Source: UniProtKB
- establishment or maintenance of transmembrane electrochemical gradient Source: HGNC-UCL
- extrinsic apoptotic signaling pathway Source: BHF-UCL
- extrinsic apoptotic signaling pathway in absence of ligand Source: GO_Central
- extrinsic apoptotic signaling pathway via death domain receptors Source: BHF-UCL
- fertilization Source: Ensembl
- germ cell development Source: Ensembl
- glycosphingolipid metabolic process Source: Ensembl
- homeostasis of number of cells within a tissue Source: Ensembl
- hypothalamus development Source: Ensembl
- intrinsic apoptotic signaling pathway Source: HGNC-UCL
- intrinsic apoptotic signaling pathway by p53 class mediator Source: Ensembl
- intrinsic apoptotic signaling pathway in response to DNA damage Source: GO_Central
- intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress Source: UniProtKB
- kidney development Source: Ensembl
- mitochondrial fragmentation involved in apoptotic process Source: HGNC-UCL
- mitochondrial fusion Source: HGNC-UCL
- mitochondrion morphogenesis Source: Ensembl
- myeloid cell homeostasis Source: Ensembl
- negative regulation of apoptotic signaling pathway Source: Ensembl
- negative regulation of endoplasmic reticulum calcium ion concentration Source: Ensembl
- negative regulation of fibroblast proliferation Source: Ensembl
- negative regulation of mitochondrial membrane potential Source: UniProtKB
- negative regulation of neuron apoptotic process Source: Ensembl
- negative regulation of peptidyl-serine phosphorylation Source: Ensembl
- negative regulation of protein binding Source: UniProtKB
- neuron apoptotic process Source: Ensembl
- neuron migration Source: Ensembl
- odontogenesis of dentin-containing tooth Source: Ensembl
- ovarian follicle development Source: Ensembl
- positive regulation of apoptotic DNA fragmentation Source: BHF-UCL
- positive regulation of apoptotic process Source: UniProtKB
- positive regulation of apoptotic process involved in mammary gland involution Source: Ensembl
- positive regulation of B cell apoptotic process Source: Ensembl
- positive regulation of developmental pigmentation Source: Ensembl
- positive regulation of endoplasmic reticulum unfolded protein response Source: UniProtKB
- positive regulation of intrinsic apoptotic signaling pathway Source: UniProtKB
- positive regulation of IRE1-mediated unfolded protein response Source: ParkinsonsUK-UCL
- positive regulation of neuron apoptotic process Source: HGNC-UCL
- positive regulation of protein-containing complex assembly Source: UniProtKB
- positive regulation of release of cytochrome c from mitochondria Source: UniProtKB
- positive regulation of release of sequestered calcium ion into cytosol Source: Ensembl
- post-embryonic camera-type eye morphogenesis Source: Ensembl
- protein insertion into mitochondrial membrane involved in apoptotic signaling pathway Source: Ensembl
- regulation of apoptotic process Source: UniProtKB
- regulation of cell cycle Source: Ensembl
- regulation of mammary gland epithelial cell proliferation Source: Ensembl
- regulation of mitochondrial membrane permeability involved in programmed necrotic cell death Source: Ensembl
- regulation of mitochondrial membrane potential Source: HGNC-UCL
- regulation of nitrogen utilization Source: Ensembl
- release of cytochrome c from mitochondria Source: UniProtKB
- release of matrix enzymes from mitochondria Source: HGNC-UCL
- response to axon injury Source: Ensembl
- response to gamma radiation Source: Ensembl
- response to salt stress Source: Ensembl
- response to toxic substance Source: HGNC-UCL
- retina development in camera-type eye Source: Ensembl
- retinal cell programmed cell death Source: Ensembl
- Sertoli cell proliferation Source: Ensembl
- spermatid differentiation Source: Ensembl
- T cell homeostatic proliferation Source: Ensembl
- thymocyte apoptotic process Source: Ensembl
- vagina development Source: Ensembl
Keywordsi
| Biological process | Apoptosis, Host-virus interaction |
Enzyme and pathway databases
| PathwayCommonsi | Q07812 |
| Reactomei | R-HSA-111457, Release of apoptotic factors from the mitochondria R-HSA-114294, Activation, translocation and oligomerization of BAX R-HSA-5620971, Pyroptosis R-HSA-6803204, TP53 Regulates Transcription of Genes Involved in Cytochrome C Release R-HSA-6804114, TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest R-HSA-8878166, Transcriptional regulation by RUNX2 R-HSA-9603505, NTRK3 as a dependence receptor |
| SIGNORi | Q07812 |
Protein family/group databases
| TCDBi | 1.A.21.1.2, the bcl-2 (bcl-2) family |
Names & Taxonomyi
| Protein namesi | Recommended name: Apoptosis regulator BAXAlternative name(s): Bcl-2-like protein 4 Short name: Bcl2-L-4 |
| Gene namesi | Name:BAX Synonyms:BCL2L4 |
| Organismi | Homo sapiens (Human) |
| Taxonomic identifieri | 9606 [NCBI] |
| Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
| Proteomesi |
|
Organism-specific databases
| HGNCi | HGNC:959, BAX |
| MIMi | 600040, gene |
| neXtProti | NX_Q07812 |
| VEuPathDBi | HostDB:ENSG00000087088 |
Subcellular locationi
Mitochondrion
- Mitochondrion outer membrane 2 Publications; Single-pass membrane protein Sequence analysis
Cytoplasm and Cytosol
- Cytoplasm 2 Publications
Note: Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane. Upon Sendai virus infection, recruited to the mitochondrion through interaction with IRF3 (PubMed:25609812).1 Publication
Cytoplasm and Cytosol
Cytoplasm and Cytosol
Cytoplasm and Cytosol
- Cytoplasm Curated
Cytosol
- cytosol Source: UniProtKB
Endoplasmic reticulum
- endoplasmic reticulum Source: HGNC-UCL
- endoplasmic reticulum membrane Source: HGNC-UCL
Extracellular region or secreted
- extracellular exosome Source: UniProtKB
Mitochondrion
- mitochondrial outer membrane Source: UniProtKB
- mitochondrial permeability transition pore complex Source: HGNC-UCL
- mitochondrion Source: UniProtKB
Nucleus
- nuclear envelope Source: AgBase
- nucleus Source: AgBase
Other locations
- BAK complex Source: ARUK-UCL
- BAX complex Source: UniProtKB
- Bcl-2 family protein complex Source: UniProtKB
- cytoplasm Source: UniProtKB
- membrane Source: UniProtKB
- pore complex Source: BHF-UCL
Topology
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Transmembranei | 172 – 192 | HelicalSequence analysisAdd BLAST | 21 |
Keywords - Cellular componenti
Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membranePathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Mutagenesisi | 21 | K → E: Reduces interaction with BCL2L11, homooligomerization and triggering of apoptosis. 1 Publication | 1 | |
| Mutagenesisi | 74 | M → D or E: Strongly reduced interaction with MCL1, BCL2, BCL2L1 and BCL2L2. No effect on cytochrome c release and subsequent apoptosis triggered by etoposide. 1 Publication | 1 | |
| Mutagenesisi | 172 – 192 | Missing : Enhanced fiber formation with humanin. 1 PublicationAdd BLAST | 21 | |
| Mutagenesisi | 184 | S → D, E, H or K: Constitutive cytoplasmic location. 1 Publication | 1 | |
| Mutagenesisi | 184 | S → V: Constitutive mitochondrial location. Enhanced fiber formation with humanin. 2 Publications | 1 |
Keywords - Diseasei
Tumor suppressorOrganism-specific databases
| DisGeNETi | 581 |
| MalaCardsi | BAX |
| OpenTargetsi | ENSG00000087088 |
| PharmGKBi | PA25269 |
Miscellaneous databases
| Pharosi | Q07812, Tchem |
Chemistry databases
| ChEMBLi | CHEMBL5318 |
Genetic variation databases
| BioMutai | BAX |
| DMDMi | 728945 |
PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| ChainiPRO_0000143053 | 1 – 192 | Apoptosis regulator BAXAdd BLAST | 192 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Modified residuei | 1 | N-acetylmethionineCombined sources | 1 |
Keywords - PTMi
AcetylationProteomic databases
| EPDi | Q07812 |
| jPOSTi | Q07812 |
| MassIVEi | Q07812 |
| MaxQBi | Q07812 |
| PaxDbi | Q07812 |
| PeptideAtlasi | Q07812 |
| PRIDEi | Q07812 |
| ProteomicsDBi | 58529 [Q07812-1] 58530 [Q07812-2] 58531 [Q07812-3] 58532 [Q07812-4] 58533 [Q07812-5] 58534 [Q07812-6] 58535 [Q07812-7] 58536 [Q07812-8] |
| TopDownProteomicsi | Q07812-1 [Q07812-1] Q07812-2 [Q07812-2] Q07812-5 [Q07812-5] Q07812-6 [Q07812-6] Q07812-8 [Q07812-8] |
PTM databases
| iPTMneti | Q07812 |
| MetOSitei | Q07812 |
| PhosphoSitePlusi | Q07812 |
| SwissPalmi | Q07812 |
Expressioni
Tissue specificityi
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.2 Publications
Gene expression databases
| Bgeei | ENSG00000087088, Expressed in mucosa of transverse colon and 211 other tissues |
| ExpressionAtlasi | Q07812, baseline and differential |
| Genevisiblei | Q07812, HS |
Organism-specific databases
| HPAi | ENSG00000087088, Low tissue specificity |
Interactioni
Subunit structurei
Homodimer. Forms higher oligomers under stress conditions. Forms heterooligomers with BAK (PubMed:29531808).
Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1 (PubMed:25609812).
Interacts with SH3GLB1.
Interacts with humanin; forms fibers with humanin which results in BAX conformational changes and sequestering of BAX into the fibers, preventing BAX activation (PubMed:12732850, PubMed:31690630).
Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L).
Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX.
Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells.
Interacts with FAIM2/LFG2.
Interacts with RTL10/BOP.
Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria.
Interacts with GIMAP3/IAN4 and GIMAP5/IAN5; this interaction is increased, when cells initiate apoptosis upon IL2 withdrawal (PubMed:16509771).
Interacts with IRF3; the interaction is direct, increases upon Sendai virus infection and mediates the formation of the apoptosis complex TOMM70:HSP90AA1:IRF3:BAX (PubMed:25609812).
19 Publications(Microbial infection) Interacts with adenovirus E1B 19K protein; this interaction blocks BAX oligomerization (PubMed:11462023).
1 Publication(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37.
1 Publication(Microbial infection) Interacts with enterovirus protein 2B; this interaction activates BAX-induced apoptosis.
1 PublicationBinary interactionsi
Q07812
GO - Molecular functioni
- BH3 domain binding Source: UniProtKB
- chaperone binding Source: Ensembl
- Hsp70 protein binding Source: Ensembl
- identical protein binding Source: UniProtKB
- protein heterodimerization activity Source: HGNC-UCL
- protein homodimerization activity Source: HGNC-UCL
Protein-protein interaction databases
| BioGRIDi | 107057, 114 interactors |
| ComplexPortali | CPX-1988, BAX oligomer |
| CORUMi | Q07812 |
| DIPi | DIP-232N |
| IntActi | Q07812, 76 interactors |
| MINTi | Q07812 |
| STRINGi | 9606.ENSP00000293288 |
Chemistry databases
| BindingDBi | Q07812 |
Miscellaneous databases
| RNActi | Q07812, protein |
Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details3D structure databases
| BMRBi | Q07812 |
| SASBDBi | Q07812 |
| SMRi | Q07812 |
| ModBasei | Search... |
| PDBe-KBi | Search... |
Miscellaneous databases
| EvolutionaryTracei | Q07812 |
Family & Domainsi
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Motifi | 59 – 73 | BH3Add BLAST | 15 | |
| Motifi | 98 – 118 | BH1Add BLAST | 21 | |
| Motifi | 150 – 165 | BH2Add BLAST | 16 |
Domaini
Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.By similarity
Sequence similaritiesi
Belongs to the Bcl-2 family.Curated
Keywords - Domaini
Transmembrane, Transmembrane helixPhylogenomic databases
| eggNOGi | KOG4728, Eukaryota |
| GeneTreei | ENSGT01040000240472 |
| HOGENOMi | CLU_3279262_0_0_1 |
| InParanoidi | Q07812 |
| OMAi | HFGTPTW |
| OrthoDBi | 1218929at2759 |
| PhylomeDBi | Q07812 |
| TreeFami | TF315834 |
Family and domain databases
| CDDi | cd06845, Bcl-2_like, 1 hit |
| Gene3Di | 1.10.437.10, 1 hit |
| InterProi | View protein in InterPro IPR026304, BAX IPR036834, Bcl-2-like_sf IPR026298, Bcl-2_fam IPR002475, Bcl2-like IPR020717, Bcl2_BH1_motif_CS IPR020726, Bcl2_BH2_motif_CS IPR020728, Bcl2_BH3_motif_CS |
| PANTHERi | PTHR11256, PTHR11256, 1 hit PTHR11256:SF42, PTHR11256:SF42, 1 hit |
| Pfami | View protein in Pfam PF00452, Bcl-2, 1 hit |
| PRINTSi | PR01862, BCL2FAMILY |
| SMARTi | View protein in SMART SM00337, BCL, 1 hit |
| SUPFAMi | SSF56854, SSF56854, 1 hit |
| PROSITEi | View protein in PROSITE PS50062, BCL2_FAMILY, 1 hit PS01080, BH1, 1 hit PS01258, BH2, 1 hit PS01259, BH3, 1 hit |
Sequences (8+)i
Sequence statusi: Complete.
This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basketThis entry has 8 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All
Isoform Alpha (identifier: Q07812-1) [UniParc]FASTAAdd to basket
This isoform has been chosen as the canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MDGSGEQPRG GGPTSSEQIM KTGALLLQGF IQDRAGRMGG EAPELALDPV
60 70 80 90 100
PQDASTKKLS ECLKRIGDEL DSNMELQRMI AAVDTDSPRE VFFRVAADMF
110 120 130 140 150
SDGNFNWGRV VALFYFASKL VLKALCTKVP ELIRTIMGWT LDFLRERLLG
160 170 180 190
WIQDQGGWDG LLSYFGTPTW QTVTIFVAGV LTASLTIWKK MG
Isoform Beta (identifier: Q07812-2) [UniParc] [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
159-192: DGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG → VRLLKPPHPH...VVYNAFSLRV
Isoform Gamma (identifier: Q07812-3) [UniParc] [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
12-41: GPTSSEQIMKTGALLLQGFIQDRAGRMGGE → VSSRIEQGEWGGRHPSWPWTRCLRMRPPRS
42-192: Missing.
Isoform Delta (identifier: Q07812-4) [UniParc] [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
30-78: Missing.
Isoform Epsilon (identifier: Q07812-5) [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
125-192: LCTKVPELIR...ASLTIWKKMG → GVKWRDLGSL...YRPCAPRCRN
Isoform Zeta (identifier: Q07812-6) [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
1-78: Missing.
Isoform Psi (identifier: Q07812-7) [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
1-19: Missing.
Isoform Sigma (identifier: Q07812-8) [UniParc]FASTAAdd to basket
The sequence of this isoform differs from the canonical sequence as follows:
159-171: Missing.
Computationally mapped potential isoform sequencesi
There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket| K4JQN1 | K4JQN1_HUMAN | Apoptosis regulator BAX | BAX | 175 | Annotation score: | ||
| H0YA56 | H0YA56_HUMAN | Apoptosis regulator BAX | BAX | 126 | Annotation score: | ||
| I6LPK7 | I6LPK7_HUMAN | Apoptosis regulator BAX | BAX | 140 | Annotation score: |
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Natural variantiVAR_013575 | 11 | G → E in a plasmacytoma cell line. 1 PublicationCorresponds to variant dbSNP:rs555248599Ensembl. | 1 | |
| Natural variantiVAR_047053 | 39 | G → R. Corresponds to variant dbSNP:rs36017265Ensembl. | 1 | |
| Natural variantiVAR_007809 | 67 | G → R in a T-cell acute lymphoblastic leukemia cell line; loss of heterodimerization with Bcl-2 or Bcl-X(L). 2 PublicationsCorresponds to variant dbSNP:rs398122513EnsemblClinVar. | 1 | |
| Natural variantiVAR_013576 | 108 | G → V in a Burkitt lymphoma; loss of homodimerization. 2 Publications | 1 |
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Alternative sequenceiVSP_031239 | 1 – 78 | Missing in isoform Zeta. 1 PublicationAdd BLAST | 78 | |
| Alternative sequenceiVSP_031238 | 1 – 19 | Missing in isoform Psi. 1 PublicationAdd BLAST | 19 | |
| Alternative sequenceiVSP_031234 | 12 – 41 | GPTSS…RMGGE → VSSRIEQGEWGGRHPSWPWT RCLRMRPPRS in isoform Gamma. 1 PublicationAdd BLAST | 30 | |
| Alternative sequenceiVSP_031235 | 30 – 78 | Missing in isoform Delta. 1 PublicationAdd BLAST | 49 | |
| Alternative sequenceiVSP_031236 | 42 – 192 | Missing in isoform Gamma. 1 PublicationAdd BLAST | 151 | |
| Alternative sequenceiVSP_031240 | 125 – 192 | LCTKV…WKKMG → GVKWRDLGSLQPLPPGFKRF TCLSIPRSWDYRPCAPRCRN in isoform Epsilon. 1 PublicationAdd BLAST | 68 | |
| Alternative sequenceiVSP_031237 | 159 – 192 | DGLLS…WKKMG → VRLLKPPHPHHRALTTAPAP PSLPPATPLGPWAFWSRSQW CPLPIFRSSDVVYNAFSLRV in isoform Beta. 1 PublicationAdd BLAST | 34 | |
| Alternative sequenceiVSP_037475 | 159 – 171 | Missing in isoform Sigma. 1 PublicationAdd BLAST | 13 |
Sequence databases
| Select the link destinations: EMBLi GenBanki DDBJi Links Updated | L22473 mRNA Translation: AAA03619.1 L22474 mRNA Translation: AAA03620.1 L22475 mRNA Translation: AAA03621.1 U19599 mRNA Translation: AAC50142.1 AF007826 mRNA Translation: AAD22706.1 AF247393 mRNA Translation: AAF71267.1 AJ417988 mRNA Translation: CAD10744.1 AF250190 mRNA Translation: AAF82094.1 AK291076 mRNA Translation: BAF83765.1 AY217036 Genomic DNA Translation: AAO22992.1 CH471177 Genomic DNA Translation: EAW52418.1 CH471177 Genomic DNA Translation: EAW52417.1 BC014175 mRNA Translation: AAH14175.1 |
| CCDSi | CCDS12742.1 [Q07812-1] CCDS12743.1 [Q07812-4] CCDS12744.1 [Q07812-2] CCDS12745.2 [Q07812-8] |
| PIRi | A47538 B47538 C47538 I38921 JC7255 |
| RefSeqi | NP_001278357.1, NM_001291428.1 NP_001278360.1, NM_001291431.1 [Q07812-6] NP_004315.1, NM_004324.3 [Q07812-2] NP_620116.1, NM_138761.3 [Q07812-1] NP_620118.1, NM_138763.3 [Q07812-4] NP_620119.2, NM_138764.4 [Q07812-8] XP_016882566.1, XM_017027077.1 [Q07812-7] |
Genome annotation databases
| Ensembli | ENST00000293288; ENSP00000293288; ENSG00000087088 [Q07812-2] ENST00000345358; ENSP00000263262; ENSG00000087088 [Q07812-1] ENST00000354470; ENSP00000346461; ENSG00000087088 [Q07812-4] ENST00000356483; ENSP00000348871; ENSG00000087088 [Q07812-5] ENST00000415969; ENSP00000389971; ENSG00000087088 [Q07812-8] ENST00000515540; ENSP00000426328; ENSG00000087088 [Q07812-3] |
| GeneIDi | 581 |
| KEGGi | hsa:581 |
| UCSCi | uc002plf.2, human [Q07812-1] |
Keywords - Coding sequence diversityi
Alternative splicingSimilar proteinsi
Cross-referencesi
Web resourcesi
| NIEHS-SNPs |
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
Sequence databases
| Select the link destinations: EMBLi GenBanki DDBJi Links Updated | L22473 mRNA Translation: AAA03619.1 L22474 mRNA Translation: AAA03620.1 L22475 mRNA Translation: AAA03621.1 U19599 mRNA Translation: AAC50142.1 AF007826 mRNA Translation: AAD22706.1 AF247393 mRNA Translation: AAF71267.1 AJ417988 mRNA Translation: CAD10744.1 AF250190 mRNA Translation: AAF82094.1 AK291076 mRNA Translation: BAF83765.1 AY217036 Genomic DNA Translation: AAO22992.1 CH471177 Genomic DNA Translation: EAW52418.1 CH471177 Genomic DNA Translation: EAW52417.1 BC014175 mRNA Translation: AAH14175.1 |
| CCDSi | CCDS12742.1 [Q07812-1] CCDS12743.1 [Q07812-4] CCDS12744.1 [Q07812-2] CCDS12745.2 [Q07812-8] |
| PIRi | A47538 B47538 C47538 I38921 JC7255 |
| RefSeqi | NP_001278357.1, NM_001291428.1 NP_001278360.1, NM_001291431.1 [Q07812-6] NP_004315.1, NM_004324.3 [Q07812-2] NP_620116.1, NM_138761.3 [Q07812-1] NP_620118.1, NM_138763.3 [Q07812-4] NP_620119.2, NM_138764.4 [Q07812-8] XP_016882566.1, XM_017027077.1 [Q07812-7] |
3D structure databases
| Select the link destinations: PDBei RCSB PDBi PDBji Links Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1F16 | NMR | - | A | 1-192 | [»] | |
| 2G5B | X-ray | 2.30 | I/J/K/L | 13-19 | [»] | |
| 2K7W | NMR | - | A | 1-192 | [»] | |
| 2LR1 | NMR | - | A | 1-192 | [»] | |
| 3PK1 | X-ray | 2.49 | B/D | 48-81 | [»] | |
| 3PL7 | X-ray | 2.61 | C | 48-81 | [»] | |
| 4BD2 | X-ray | 2.21 | A | 1-171 | [»] | |
| 4BD6 | X-ray | 2.49 | A | 1-171 | [»] | |
| C | 48-81 | [»] | ||||
| 4BD7 | X-ray | 2.80 | A/B/C/D | 1-171 | [»] | |
| 4BD8 | X-ray | 2.22 | A/B/C/D | 1-171 | [»] | |
| 4BDU | X-ray | 3.00 | A/B/C/D | 53-128 | [»] | |
| 4S0O | X-ray | 1.90 | A/B | 1-192 | [»] | |
| 4S0P | X-ray | 3.25 | A/B | 1-192 | [»] | |
| 4UF2 | X-ray | 3.00 | B | 50-77 | [»] | |
| 4ZIE | X-ray | 1.80 | A | 1-166 | [»] | |
| 4ZIF | X-ray | 2.40 | A | 1-166 | [»] | |
| 4ZIG | X-ray | 2.20 | A | 1-166 | [»] | |
| 4ZIH | X-ray | 2.50 | A | 1-164 | [»] | |
| 4ZII | X-ray | 2.19 | A | 1-170 | [»] | |
| 5W5X | X-ray | 2.50 | A | 1-192 | [»] | |
| 5W5Z | X-ray | 2.00 | A | 32-192 | [»] | |
| 5W60 | X-ray | 1.80 | A | 1-192 | [»] | |
| 5W61 | X-ray | 2.30 | A | 1-192 | [»] | |
| 6EB6 | X-ray | 2.02 | A | 1-192 | [»] | |
| 6L8V | NMR | - | A/B | 53-128 | [»] | |
| 6L95 | NMR | - | A/B | 166-192 | [»] | |
| 6TRR | X-ray | 2.12 | B | 50-77 | [»] | |
| 6XY6 | X-ray | 2.91 | B/D/F/H/J/L/N/P | 50-77 | [»] | |
| BMRBi | Q07812 | |||||
| SASBDBi | Q07812 | |||||
| SMRi | Q07812 | |||||
| ModBasei | Search... | |||||
| PDBe-KBi | Search... | |||||
Protein-protein interaction databases
| BioGRIDi | 107057, 114 interactors |
| ComplexPortali | CPX-1988, BAX oligomer |
| CORUMi | Q07812 |
| DIPi | DIP-232N |
| IntActi | Q07812, 76 interactors |
| MINTi | Q07812 |
| STRINGi | 9606.ENSP00000293288 |
Chemistry databases
| BindingDBi | Q07812 |
| ChEMBLi | CHEMBL5318 |
Protein family/group databases
| TCDBi | 1.A.21.1.2, the bcl-2 (bcl-2) family |
PTM databases
| iPTMneti | Q07812 |
| MetOSitei | Q07812 |
| PhosphoSitePlusi | Q07812 |
| SwissPalmi | Q07812 |
Genetic variation databases
| BioMutai | BAX |
| DMDMi | 728945 |
Proteomic databases
| EPDi | Q07812 |
| jPOSTi | Q07812 |
| MassIVEi | Q07812 |
| MaxQBi | Q07812 |
| PaxDbi | Q07812 |
| PeptideAtlasi | Q07812 |
| PRIDEi | Q07812 |
| ProteomicsDBi | 58529 [Q07812-1] 58530 [Q07812-2] 58531 [Q07812-3] 58532 [Q07812-4] 58533 [Q07812-5] 58534 [Q07812-6] 58535 [Q07812-7] 58536 [Q07812-8] |
| TopDownProteomicsi | Q07812-1 [Q07812-1] Q07812-2 [Q07812-2] Q07812-5 [Q07812-5] Q07812-6 [Q07812-6] Q07812-8 [Q07812-8] |
Protocols and materials databases
| ABCDi | Q07812, 21 sequenced antibodies |
| Antibodypediai | 3777, 2119 antibodies |
| CPTCi | Q07812, 1 antibody |
| DNASUi | 581 |
Genome annotation databases
| Ensembli | ENST00000293288; ENSP00000293288; ENSG00000087088 [Q07812-2] ENST00000345358; ENSP00000263262; ENSG00000087088 [Q07812-1] ENST00000354470; ENSP00000346461; ENSG00000087088 [Q07812-4] ENST00000356483; ENSP00000348871; ENSG00000087088 [Q07812-5] ENST00000415969; ENSP00000389971; ENSG00000087088 [Q07812-8] ENST00000515540; ENSP00000426328; ENSG00000087088 [Q07812-3] |
| GeneIDi | 581 |
| KEGGi | hsa:581 |
| UCSCi | uc002plf.2, human [Q07812-1] |
Organism-specific databases
| CTDi | 581 |
| DisGeNETi | 581 |
| GeneCardsi | BAX |
| HGNCi | HGNC:959, BAX |
| HPAi | ENSG00000087088, Low tissue specificity |
| MalaCardsi | BAX |
| MIMi | 600040, gene |
| neXtProti | NX_Q07812 |
| OpenTargetsi | ENSG00000087088 |
| PharmGKBi | PA25269 |
| VEuPathDBi | HostDB:ENSG00000087088 |
| GenAtlasi | Search... |
Phylogenomic databases
| eggNOGi | KOG4728, Eukaryota |
| GeneTreei | ENSGT01040000240472 |
| HOGENOMi | CLU_3279262_0_0_1 |
| InParanoidi | Q07812 |
| OMAi | HFGTPTW |
| OrthoDBi | 1218929at2759 |
| PhylomeDBi | Q07812 |
| TreeFami | TF315834 |
Enzyme and pathway databases
| PathwayCommonsi | Q07812 |
| Reactomei | R-HSA-111457, Release of apoptotic factors from the mitochondria R-HSA-114294, Activation, translocation and oligomerization of BAX R-HSA-5620971, Pyroptosis R-HSA-6803204, TP53 Regulates Transcription of Genes Involved in Cytochrome C Release R-HSA-6804114, TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest R-HSA-8878166, Transcriptional regulation by RUNX2 R-HSA-9603505, NTRK3 as a dependence receptor |
| SIGNORi | Q07812 |
Miscellaneous databases
| BioGRID-ORCSi | 581, 21 hits in 1027 CRISPR screens |
| ChiTaRSi | BAX, human |
| EvolutionaryTracei | Q07812 |
| GeneWikii | Bcl-2-associated_X_protein |
| GenomeRNAii | 581 |
| Pharosi | Q07812, Tchem |
| PROi | PR:Q07812 |
| RNActi | Q07812, protein |
| SOURCEi | Search... |
Gene expression databases
| Bgeei | ENSG00000087088, Expressed in mucosa of transverse colon and 211 other tissues |
| ExpressionAtlasi | Q07812, baseline and differential |
| Genevisiblei | Q07812, HS |
Family and domain databases
| CDDi | cd06845, Bcl-2_like, 1 hit |
| Gene3Di | 1.10.437.10, 1 hit |
| InterProi | View protein in InterPro IPR026304, BAX IPR036834, Bcl-2-like_sf IPR026298, Bcl-2_fam IPR002475, Bcl2-like IPR020717, Bcl2_BH1_motif_CS IPR020726, Bcl2_BH2_motif_CS IPR020728, Bcl2_BH3_motif_CS |
| PANTHERi | PTHR11256, PTHR11256, 1 hit PTHR11256:SF42, PTHR11256:SF42, 1 hit |
| Pfami | View protein in Pfam PF00452, Bcl-2, 1 hit |
| PRINTSi | PR01862, BCL2FAMILY |
| SMARTi | View protein in SMART SM00337, BCL, 1 hit |
| SUPFAMi | SSF56854, SSF56854, 1 hit |
| PROSITEi | View protein in PROSITE PS50062, BCL2_FAMILY, 1 hit PS01080, BH1, 1 hit PS01258, BH2, 1 hit PS01259, BH3, 1 hit |
| MobiDBi | Search... |
Entry informationi
| Entry namei | BAX_HUMAN | |
| Accessioni | Q07812Primary (citable) accession number: Q07812 Secondary accession number(s): A8K4W1 Q9UQD6 | |
| Entry historyi | Integrated into UniProtKB/Swiss-Prot: | February 1, 1995 |
| Last sequence update: | February 1, 1995 | |
| Last modified: | September 29, 2021 | |
| This is version 226 of the entry and version 1 of the sequence. See complete history. | ||
| Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
Miscellaneousi
Keywords - Technical termi
3D-structure, Reference proteomeDocuments
- Human chromosome 19
Human chromosome 19: entries, gene names and cross-references to MIM - Human entries with genetic variants
List of human entries with genetic variants - Human variants curated from literature reports
Index of human variants curated from literature reports - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - SIMILARITY comments
Index of protein domains and families
