Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Apoptosis regulator BAX

Gene

BAX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.7 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processApoptosis, Host-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-111457 Release of apoptotic factors from the mitochondria
R-HSA-114294 Activation, translocation and oligomerization of BAX
R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-8878166 Transcriptional regulation by RUNX2
R-HSA-9603505 NTRK3 as a dependence receptor
SIGNORiQ07812

Protein family/group databases

TCDBi1.A.21.1.2 the bcl-2 (bcl-2) family

Names & Taxonomyi

Protein namesi
Recommended name:
Apoptosis regulator BAX
Alternative name(s):
Bcl-2-like protein 4
Short name:
Bcl2-L-4
Gene namesi
Name:BAX
Synonyms:BCL2L4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000087088.19
HGNCiHGNC:959 BAX
MIMi600040 gene
neXtProtiNX_Q07812

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei172 – 192HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi21K → E: Reduces interaction with BCL2L11, homooligomerization and triggering of apoptosis. 1 Publication1
Mutagenesisi74M → D or E: Strongly reduced interaction with MCL1, BCL2, BCL2L1 and BCL2L2. No effect on cytochrome c release and subsequent apoptosis triggered by etoposide. 1 Publication1
Mutagenesisi184S → D, E, H or K: Constitutive cytoplasmic location. 1 Publication1
Mutagenesisi184S → V: Constitutive mitochondrial location. 1 Publication1

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNETi581
MalaCardsiBAX
OpenTargetsiENSG00000087088
PharmGKBiPA25269

Chemistry databases

ChEMBLiCHEMBL5318

Polymorphism and mutation databases

BioMutaiBAX
DMDMi728945

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001430531 – 192Apoptosis regulator BAXAdd BLAST192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ07812
MaxQBiQ07812
PaxDbiQ07812
PeptideAtlasiQ07812
PRIDEiQ07812
ProteomicsDBi58529
58530 [Q07812-2]
58531 [Q07812-3]
58532 [Q07812-4]
58533 [Q07812-5]
58534 [Q07812-6]
58535 [Q07812-7]
58536 [Q07812-8]
TopDownProteomicsiQ07812-1 [Q07812-1]
Q07812-2 [Q07812-2]
Q07812-5 [Q07812-5]
Q07812-6 [Q07812-6]
Q07812-8 [Q07812-8]

PTM databases

iPTMnetiQ07812
PhosphoSitePlusiQ07812
SwissPalmiQ07812

Miscellaneous databases

PMAP-CutDBiQ07812

Expressioni

Tissue specificityi

Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.2 Publications

Gene expression databases

BgeeiENSG00000087088 Expressed in 197 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_BAX
ExpressionAtlasiQ07812 baseline and differential
GenevisibleiQ07812 HS

Organism-specific databases

HPAiCAB004206
HPA027878

Interactioni

Subunit structurei

Homodimer. Forms higher oligomers under stress conditions. Forms heterooligomers with BAK (PubMed:29531808). Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with RTL10/BOP. Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria.16 Publications
(Microbial infection) Interacts with adenovirus E1B 19K protein; this interaction blocks BAX oligomerization (PubMed:11462023).1 Publication
(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37.1 Publication
(Microbial infection) Interacts with enterovirus protein 2B; this interaction activates BAX-induced apoptosis.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107057, 81 interactors
ComplexPortaliCPX-1988 BAX oligomer
CORUMiQ07812
DIPiDIP-232N
IntActiQ07812, 71 interactors
MINTiQ07812
STRINGi9606.ENSP00000293288

Chemistry databases

BindingDBiQ07812

Structurei

Secondary structure

1192
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ07812
SMRiQ07812
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ07812

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi59 – 73BH3Add BLAST15
Motifi98 – 118BH1Add BLAST21
Motifi150 – 165BH2Add BLAST16

Domaini

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.By similarity

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IWQJ Eukaryota
ENOG4112738 LUCA
GeneTreeiENSGT00730000111112
HOVERGENiHBG003606
InParanoidiQ07812
KOiK02159
OMAiVINWIRE
OrthoDBiEOG091G0YWR
PhylomeDBiQ07812
TreeFamiTF315834

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR026304 BAX
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR020728 Bcl2_BH3_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF42 PTHR11256:SF42, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PRINTSiPR01862 BCL2FAMILY
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01259 BH3, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: Q07812-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGSGEQPRG GGPTSSEQIM KTGALLLQGF IQDRAGRMGG EAPELALDPV
60 70 80 90 100
PQDASTKKLS ECLKRIGDEL DSNMELQRMI AAVDTDSPRE VFFRVAADMF
110 120 130 140 150
SDGNFNWGRV VALFYFASKL VLKALCTKVP ELIRTIMGWT LDFLRERLLG
160 170 180 190
WIQDQGGWDG LLSYFGTPTW QTVTIFVAGV LTASLTIWKK MG
Length:192
Mass (Da):21,184
Last modified:February 1, 1995 - v1
Checksum:i6C0CDB0A7DEE4994
GO
Isoform Beta (identifier: Q07812-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-192: DGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG → VRLLKPPHPH...VVYNAFSLRV

Show »
Length:218
Mass (Da):24,220
Checksum:iF69DCD70F960192F
GO
Isoform Gamma (identifier: Q07812-3) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-41: GPTSSEQIMKTGALLLQGFIQDRAGRMGGE → VSSRIEQGEWGGRHPSWPWTRCLRMRPPRS
     42-192: Missing.

Show »
Length:41
Mass (Da):4,678
Checksum:iD94639AABB927859
GO
Isoform Delta (identifier: Q07812-4) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-78: Missing.

Show »
Length:143
Mass (Da):15,772
Checksum:iBADE4D71D06A75AB
GO
Isoform Epsilon (identifier: Q07812-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-192: LCTKVPELIR...ASLTIWKKMG → GVKWRDLGSL...YRPCAPRCRN

Show »
Length:164
Mass (Da):18,129
Checksum:i12CCDB8073EF4C9E
GO
Isoform Zeta (identifier: Q07812-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Show »
Length:114
Mass (Da):12,887
Checksum:iA9DAFC5C06E36F4A
GO
Isoform Psi (identifier: Q07812-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.

Show »
Length:173
Mass (Da):19,312
Checksum:i266F3151438B6201
GO
Isoform Sigma (identifier: Q07812-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-171: Missing.

Show »
Length:179
Mass (Da):19,718
Checksum:i5802B0AC73B2E4CE
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YA56H0YA56_HUMAN
Apoptosis regulator BAX
BAX
126Annotation score:
K4JQN1K4JQN1_HUMAN
Apoptosis regulator BAX
BAX
175Annotation score:
I6LPK7I6LPK7_HUMAN
Apoptosis regulator BAX
BAX
140Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01357511G → E in a plasmacytoma cell line. 1 PublicationCorresponds to variant dbSNP:rs555248599Ensembl.1
Natural variantiVAR_04705339G → R. Corresponds to variant dbSNP:rs36017265Ensembl.1
Natural variantiVAR_00780967G → R in a T-cell acute lymphoblastic leukemia cell line; loss of heterodimerization with Bcl-2 or Bcl-X(L). 2 PublicationsCorresponds to variant dbSNP:rs398122513EnsemblClinVar.1
Natural variantiVAR_013576108G → V in a Burkitt lymphoma; loss of homodimerization. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0312391 – 78Missing in isoform Zeta. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_0312381 – 19Missing in isoform Psi. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_03123412 – 41GPTSS…RMGGE → VSSRIEQGEWGGRHPSWPWT RCLRMRPPRS in isoform Gamma. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03123530 – 78Missing in isoform Delta. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_03123642 – 192Missing in isoform Gamma. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_031240125 – 192LCTKV…WKKMG → GVKWRDLGSLQPLPPGFKRF TCLSIPRSWDYRPCAPRCRN in isoform Epsilon. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_031237159 – 192DGLLS…WKKMG → VRLLKPPHPHHRALTTAPAP PSLPPATPLGPWAFWSRSQW CPLPIFRSSDVVYNAFSLRV in isoform Beta. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_037475159 – 171Missing in isoform Sigma. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L22473 mRNA Translation: AAA03619.1
L22474 mRNA Translation: AAA03620.1
L22475 mRNA Translation: AAA03621.1
U19599 mRNA Translation: AAC50142.1
AF007826 mRNA Translation: AAD22706.1
AF247393 mRNA Translation: AAF71267.1
AJ417988 mRNA Translation: CAD10744.1
AF250190 mRNA Translation: AAF82094.1
AK291076 mRNA Translation: BAF83765.1
AY217036 Genomic DNA Translation: AAO22992.1
CH471177 Genomic DNA Translation: EAW52418.1
CH471177 Genomic DNA Translation: EAW52417.1
BC014175 mRNA Translation: AAH14175.1
CCDSiCCDS12742.1 [Q07812-1]
CCDS12743.1 [Q07812-4]
CCDS12744.1 [Q07812-2]
CCDS12745.2 [Q07812-8]
PIRiA47538
B47538
C47538
I38921
JC7255
RefSeqiNP_001278357.1, NM_001291428.1
NP_001278360.1, NM_001291431.1 [Q07812-6]
NP_004315.1, NM_004324.3 [Q07812-2]
NP_620116.1, NM_138761.3 [Q07812-1]
NP_620118.1, NM_138763.3 [Q07812-4]
NP_620119.2, NM_138764.4 [Q07812-8]
XP_016882566.1, XM_017027077.1 [Q07812-7]
UniGeneiHs.624291

Genome annotation databases

EnsembliENST00000293288; ENSP00000293288; ENSG00000087088 [Q07812-2]
ENST00000345358; ENSP00000263262; ENSG00000087088 [Q07812-1]
ENST00000354470; ENSP00000346461; ENSG00000087088 [Q07812-4]
ENST00000356483; ENSP00000348871; ENSG00000087088 [Q07812-5]
ENST00000415969; ENSP00000389971; ENSG00000087088 [Q07812-8]
ENST00000515540; ENSP00000426328; ENSG00000087088 [Q07812-3]
GeneIDi581
KEGGihsa:581
UCSCiuc002plf.2 human [Q07812-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L22473 mRNA Translation: AAA03619.1
L22474 mRNA Translation: AAA03620.1
L22475 mRNA Translation: AAA03621.1
U19599 mRNA Translation: AAC50142.1
AF007826 mRNA Translation: AAD22706.1
AF247393 mRNA Translation: AAF71267.1
AJ417988 mRNA Translation: CAD10744.1
AF250190 mRNA Translation: AAF82094.1
AK291076 mRNA Translation: BAF83765.1
AY217036 Genomic DNA Translation: AAO22992.1
CH471177 Genomic DNA Translation: EAW52418.1
CH471177 Genomic DNA Translation: EAW52417.1
BC014175 mRNA Translation: AAH14175.1
CCDSiCCDS12742.1 [Q07812-1]
CCDS12743.1 [Q07812-4]
CCDS12744.1 [Q07812-2]
CCDS12745.2 [Q07812-8]
PIRiA47538
B47538
C47538
I38921
JC7255
RefSeqiNP_001278357.1, NM_001291428.1
NP_001278360.1, NM_001291431.1 [Q07812-6]
NP_004315.1, NM_004324.3 [Q07812-2]
NP_620116.1, NM_138761.3 [Q07812-1]
NP_620118.1, NM_138763.3 [Q07812-4]
NP_620119.2, NM_138764.4 [Q07812-8]
XP_016882566.1, XM_017027077.1 [Q07812-7]
UniGeneiHs.624291

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F16NMR-A1-192[»]
2G5BX-ray2.30I/J/K/L13-19[»]
2K7WNMR-A1-192[»]
2LR1NMR-A1-192[»]
3PK1X-ray2.49B/D48-81[»]
3PL7X-ray2.61C48-81[»]
4BD2X-ray2.21A1-171[»]
4BD6X-ray2.49A1-171[»]
C48-81[»]
4BD7X-ray2.80A/B/C/D1-171[»]
4BD8X-ray2.22A/B/C/D1-171[»]
4BDUX-ray3.00A/B/C/D53-128[»]
4S0OX-ray1.90A/B1-192[»]
4S0PX-ray3.25A/B1-192[»]
4UF2X-ray3.00B50-77[»]
4ZIEX-ray1.80A1-166[»]
4ZIFX-ray2.40A1-166[»]
4ZIGX-ray2.20A1-166[»]
4ZIHX-ray2.50A1-164[»]
4ZIIX-ray2.19A1-170[»]
5W5XX-ray2.50A1-192[»]
5W5ZX-ray2.00A32-192[»]
5W60X-ray1.80A1-192[»]
5W61X-ray2.30A1-192[»]
ProteinModelPortaliQ07812
SMRiQ07812
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107057, 81 interactors
ComplexPortaliCPX-1988 BAX oligomer
CORUMiQ07812
DIPiDIP-232N
IntActiQ07812, 71 interactors
MINTiQ07812
STRINGi9606.ENSP00000293288

Chemistry databases

BindingDBiQ07812
ChEMBLiCHEMBL5318

Protein family/group databases

TCDBi1.A.21.1.2 the bcl-2 (bcl-2) family

PTM databases

iPTMnetiQ07812
PhosphoSitePlusiQ07812
SwissPalmiQ07812

Polymorphism and mutation databases

BioMutaiBAX
DMDMi728945

Proteomic databases

EPDiQ07812
MaxQBiQ07812
PaxDbiQ07812
PeptideAtlasiQ07812
PRIDEiQ07812
ProteomicsDBi58529
58530 [Q07812-2]
58531 [Q07812-3]
58532 [Q07812-4]
58533 [Q07812-5]
58534 [Q07812-6]
58535 [Q07812-7]
58536 [Q07812-8]
TopDownProteomicsiQ07812-1 [Q07812-1]
Q07812-2 [Q07812-2]
Q07812-5 [Q07812-5]
Q07812-6 [Q07812-6]
Q07812-8 [Q07812-8]

Protocols and materials databases

DNASUi581
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000293288; ENSP00000293288; ENSG00000087088 [Q07812-2]
ENST00000345358; ENSP00000263262; ENSG00000087088 [Q07812-1]
ENST00000354470; ENSP00000346461; ENSG00000087088 [Q07812-4]
ENST00000356483; ENSP00000348871; ENSG00000087088 [Q07812-5]
ENST00000415969; ENSP00000389971; ENSG00000087088 [Q07812-8]
ENST00000515540; ENSP00000426328; ENSG00000087088 [Q07812-3]
GeneIDi581
KEGGihsa:581
UCSCiuc002plf.2 human [Q07812-1]

Organism-specific databases

CTDi581
DisGeNETi581
EuPathDBiHostDB:ENSG00000087088.19
GeneCardsiBAX
HGNCiHGNC:959 BAX
HPAiCAB004206
HPA027878
MalaCardsiBAX
MIMi600040 gene
neXtProtiNX_Q07812
OpenTargetsiENSG00000087088
PharmGKBiPA25269
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWQJ Eukaryota
ENOG4112738 LUCA
GeneTreeiENSGT00730000111112
HOVERGENiHBG003606
InParanoidiQ07812
KOiK02159
OMAiVINWIRE
OrthoDBiEOG091G0YWR
PhylomeDBiQ07812
TreeFamiTF315834

Enzyme and pathway databases

ReactomeiR-HSA-111457 Release of apoptotic factors from the mitochondria
R-HSA-114294 Activation, translocation and oligomerization of BAX
R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-8878166 Transcriptional regulation by RUNX2
R-HSA-9603505 NTRK3 as a dependence receptor
SIGNORiQ07812

Miscellaneous databases

ChiTaRSiBAX human
EvolutionaryTraceiQ07812
GeneWikiiBcl-2-associated_X_protein
GenomeRNAii581
PMAP-CutDBiQ07812
PROiPR:Q07812
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000087088 Expressed in 197 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_BAX
ExpressionAtlasiQ07812 baseline and differential
GenevisibleiQ07812 HS

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR026304 BAX
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR020728 Bcl2_BH3_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF42 PTHR11256:SF42, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PRINTSiPR01862 BCL2FAMILY
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01259 BH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBAX_HUMAN
AccessioniPrimary (citable) accession number: Q07812
Secondary accession number(s): A8K4W1
, P55269, Q07814, Q07815, Q8WZ49, Q9NR76, Q9NYG7, Q9UCZ6, Q9UCZ7, Q9UQD6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: October 10, 2018
This is version 203 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again