Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NKG2-E type II integral membrane protein

Gene

KLRC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
LigandLectin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NKG2-E type II integral membrane protein
Alternative name(s):
NK cell receptor E
NKG2-E-activating NK receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLRC3
Synonyms:NKG2E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000205810.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6376 KLRC3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602892 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q07444

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 70CytoplasmicSequence analysisAdd BLAST70
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei71 – 93Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini94 – 240ExtracellularSequence analysisAdd BLAST147

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000205810

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30165

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KLRC3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439288

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000466711 – 240NKG2-E type II integral membrane proteinAdd BLAST240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi100N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi117 ↔ 128PROSITE-ProRule annotation
Glycosylationi149N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi179N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi207 ↔ 220PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q07444

PeptideAtlas

More...
PeptideAtlasi
Q07444

PRoteomics IDEntifications database

More...
PRIDEi
Q07444

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58516
58517 [Q07444-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q07444

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q07444

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Natural killer cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000205810 Expressed in 72 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_KLRC3

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q07444 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039910
HPA062570

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form disulfide-bonded heterodimer with CD94.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110022, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q07444, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000437563

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q07444

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q07444

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini116 – 230C-type lectinPROSITE-ProRule annotationAdd BLAST115

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWW4 Eukaryota
ENOG410ZFTY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163686

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220925

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG077044

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q07444

KEGG Orthology (KO)

More...
KOi
K06541

Identification of Orthologs from Complete Genome Data

More...
OMAi
LISTHNC

Database of Orthologous Groups

More...
OrthoDBi
1161111at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q07444

TreeFam database of animal gene trees

More...
TreeFami
TF336674

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03593 CLECT_NK_receptors_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00059 Lectin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00034 CLECT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56436 SSF56436, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform NKG2-E (identifier: Q07444-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKQRGTFSE VSLAQDPKWQ QRKPKGNKSS ISGTEQEIFQ VELNLQNASL
60 70 80 90 100
NHQGIDKIYD CQGLLPPPEK LTAEVLGIIC IVLMATVLKT IVLIPFLEQN
110 120 130 140 150
NSSPNARTQK ARHCGHCPEE WITYSNSCYY IGKERRTWEE SLQACASKNS
160 170 180 190 200
SSLLCIDNEE EMKFLASILP SSWIGVFRNS SHHPWVTING LAFKHEIKDS
210 220 230 240
DHAERNCAML HVRGLISDQC GSSRIIRRGF IMLTRLVLNS
Length:240
Mass (Da):27,100
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9F7056DD558A40C3
GO
Isoform NKG2-H (identifier: Q07444-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-240: RRGFIMLTRLVLNS → VSISFRIKALELAVHQIKFYICSNRNDIMIA

Show »
Length:257
Mass (Da):29,018
Checksum:i1DFECB6179F43783
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti48A → P in AAL65232 (Ref. 5) Curated1
Sequence conflicti134E → G in AAL65232 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0629542S → N4 PublicationsCorresponds to variant dbSNP:rs2682489Ensembl.1
Natural variantiVAR_01329619W → P in allele NKG2-E*01 and allele NKG2-E*03; requires 2 nucleotide substitutions. 3 PublicationsCorresponds to variant dbSNP:rs796361824Ensembl.1
Natural variantiVAR_06313219W → R in allele NKG2-E*02. 2 PublicationsCorresponds to variant dbSNP:rs2682490Ensembl.1
Natural variantiVAR_063133106A → T4 PublicationsCorresponds to variant dbSNP:rs28626640Ensembl.1
Natural variantiVAR_062955113H → P5 PublicationsCorresponds to variant dbSNP:rs2682494Ensembl.1
Natural variantiVAR_014660135R → S. Corresponds to variant dbSNP:rs1138437Ensembl.1
Natural variantiVAR_062956155C → S4 PublicationsCorresponds to variant dbSNP:rs2682495Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003067227 – 240RRGFI…LVLNS → VSISFRIKALELAVHQIKFY ICSNRNDIMIA in isoform NKG2-H. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L14542 mRNA Translation: AAA16833.1
AJ001685 Genomic DNA Translation: CAA04923.1
AF078550 mRNA Translation: AAD46108.1
AF350016 mRNA Translation: AAK83803.1
AF350017 mRNA Translation: AAK83804.1
AF461157 mRNA Translation: AAL65232.1
AC022075 Genomic DNA No translation available.
AC068775 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31744.1 [Q07444-2]
CCDS41755.1 [Q07444-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
I54524

NCBI Reference Sequences

More...
RefSeqi
NP_002252.2, NM_002261.2 [Q07444-1]
NP_031359.2, NM_007333.2 [Q07444-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654362

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000381903; ENSP00000371328; ENSG00000205810 [Q07444-2]
ENST00000396439; ENSP00000379716; ENSG00000205810 [Q07444-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3823

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3823

UCSC genome browser

More...
UCSCi
uc001qyf.4 human [Q07444-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

NKG-2E

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L14542 mRNA Translation: AAA16833.1
AJ001685 Genomic DNA Translation: CAA04923.1
AF078550 mRNA Translation: AAD46108.1
AF350016 mRNA Translation: AAK83803.1
AF350017 mRNA Translation: AAK83804.1
AF461157 mRNA Translation: AAL65232.1
AC022075 Genomic DNA No translation available.
AC068775 Genomic DNA No translation available.
CCDSiCCDS31744.1 [Q07444-2]
CCDS41755.1 [Q07444-1]
PIRiI54524
RefSeqiNP_002252.2, NM_002261.2 [Q07444-1]
NP_031359.2, NM_007333.2 [Q07444-2]
UniGeneiHs.654362

3D structure databases

ProteinModelPortaliQ07444
SMRiQ07444
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110022, 2 interactors
IntActiQ07444, 1 interactor
STRINGi9606.ENSP00000437563

PTM databases

iPTMnetiQ07444
PhosphoSitePlusiQ07444

Polymorphism and mutation databases

BioMutaiKLRC3
DMDMi296439288

Proteomic databases

PaxDbiQ07444
PeptideAtlasiQ07444
PRIDEiQ07444
ProteomicsDBi58516
58517 [Q07444-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3823
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381903; ENSP00000371328; ENSG00000205810 [Q07444-2]
ENST00000396439; ENSP00000379716; ENSG00000205810 [Q07444-1]
GeneIDi3823
KEGGihsa:3823
UCSCiuc001qyf.4 human [Q07444-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3823
EuPathDBiHostDB:ENSG00000205810.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KLRC3
HGNCiHGNC:6376 KLRC3
HPAiHPA039910
HPA062570
MIMi602892 gene
neXtProtiNX_Q07444
OpenTargetsiENSG00000205810
PharmGKBiPA30165

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWW4 Eukaryota
ENOG410ZFTY LUCA
GeneTreeiENSGT00940000163686
HOGENOMiHOG000220925
HOVERGENiHBG077044
InParanoidiQ07444
KOiK06541
OMAiLISTHNC
OrthoDBi1161111at2759
PhylomeDBiQ07444
TreeFamiTF336674

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3823

Protein Ontology

More...
PROi
PR:Q07444

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000205810 Expressed in 72 organ(s), highest expression level in corpus callosum
CleanExiHS_KLRC3
GenevisibleiQ07444 HS

Family and domain databases

CDDicd03593 CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNKG2E_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q07444
Secondary accession number(s): Q8WXA4, Q96RL0, Q9UP04
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 18, 2010
Last modified: January 16, 2019
This is version 156 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again