Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphatidylinositol-glycan biosynthesis class F protein

Gene

PIGF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.By similarity

Pathwayi: glycosylphosphatidylinositol-anchor biosynthesis

This protein is involved in the pathway glycosylphosphatidylinositol-anchor biosynthesis, which is part of Glycolipid biosynthesis.
View all proteins of this organism that are known to be involved in the pathway glycosylphosphatidylinositol-anchor biosynthesis and in Glycolipid biosynthesis.

GO - Molecular functioni

  • ethanolaminephosphotransferase activity Source: ProtInc

GO - Biological processi

Keywordsi

Biological processGPI-anchor biosynthesis

Enzyme and pathway databases

ReactomeiR-HSA-162710 Synthesis of glycosylphosphatidylinositol (GPI)
UniPathwayi
UPA00196

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylinositol-glycan biosynthesis class F protein
Short name:
PIG-F
Alternative name(s):
GPI11 homolog
Gene namesi
Name:PIGF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000151665.12
HGNCiHGNC:8962 PIGF
MIMi600153 gene
neXtProtiNX_Q07326

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei11 – 31HelicalSequence analysisAdd BLAST21
Transmembranei42 – 62HelicalSequence analysisAdd BLAST21
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Transmembranei113 – 133HelicalSequence analysisAdd BLAST21
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Transmembranei189 – 209HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5281
OpenTargetsiENSG00000151665
PharmGKBiPA33293

Polymorphism and mutation databases

BioMutaiPIGF
DMDMi730326

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001917591 – 219Phosphatidylinositol-glycan biosynthesis class F proteinAdd BLAST219

Proteomic databases

PaxDbiQ07326
PRIDEiQ07326
ProteomicsDBi58510
58511 [Q07326-2]

Expressioni

Gene expression databases

BgeeiENSG00000151665 Expressed in 207 organ(s), highest expression level in oocyte
CleanExiHS_PIGF
ExpressionAtlasiQ07326 baseline and differential
GenevisibleiQ07326 HS

Organism-specific databases

HPAiHPA051389

Interactioni

Subunit structurei

Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO.

Protein-protein interaction databases

IntActiQ07326, 5 interactors
STRINGi9606.ENSP00000281382

Structurei

3D structure databases

ProteinModelPortaliQ07326
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the PIGF family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3144 Eukaryota
ENOG4111B1J LUCA
GeneTreeiENSGT00390000016617
HOGENOMiHOG000082526
HOVERGENiHBG031820
InParanoidiQ07326
KOiK05287
OMAiWPISCSL
OrthoDBiEOG091G0HMT
PhylomeDBiQ07326
TreeFamiTF323878

Family and domain databases

InterProiView protein in InterPro
IPR009580 GPI_biosynthesis_protein_Pig-F
PfamiView protein in Pfam
PF06699 PIG-F, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q07326-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDNDIKRLL YTHLLCIFSI ILSVFIPSLF LENFSILETH LTWLCICSGF
60 70 80 90 100
VTAVNLVLYL VVKPNTSSKR SSLSHKVTGF LKCCIYFLMS CFSFHVIFVL
110 120 130 140 150
YGAPLIELAL ETFLFAVILS TFTTVPCLCL LGPNLKAWLR VFSRNGVTSI
160 170 180 190 200
WENSLQITTI SSFVGAWLGA LPIPLDWERP WQVWPISCTL GATFGYVAGL
210
VISPLWIYWN RKQLTYKNN
Length:219
Mass (Da):24,890
Last modified:February 1, 1995 - v1
Checksum:i313F97A55B781EBF
GO
Isoform 2 (identifier: Q07326-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-219: VWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN → MTVERKRSTYRSLHVPCRGLGTVK

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):23,391
Checksum:i2448DBF73784B1F4
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RIN5E5RIN5_HUMAN
Phosphatidylinositol-glycan biosynt...
PIGF
49Annotation score:
F8WEN5F8WEN5_HUMAN
Phosphatidylinositol-glycan biosynt...
PIGF
112Annotation score:
H7C392H7C392_HUMAN
Phosphatidylinositol-glycan biosynt...
PIGF
57Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_004361183 – 219VWPIS…TYKNN → MTVERKRSTYRSLHVPCRGL GTVK in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13435 mRNA Translation: BAA02697.1
BC021725 mRNA Translation: AAH21725.1
BC029408 mRNA Translation: AAH29408.1
CCDSiCCDS1827.1 [Q07326-1]
CCDS1828.1 [Q07326-2]
PIRiA46097
RefSeqiNP_002634.1, NM_002643.3 [Q07326-1]
NP_775097.1, NM_173074.2 [Q07326-2]
UniGeneiHs.468415

Genome annotation databases

EnsembliENST00000281382; ENSP00000281382; ENSG00000151665 [Q07326-1]
ENST00000306465; ENSP00000302663; ENSG00000151665 [Q07326-2]
GeneIDi5281
KEGGihsa:5281
UCSCiuc002rvc.4 human [Q07326-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13435 mRNA Translation: BAA02697.1
BC021725 mRNA Translation: AAH21725.1
BC029408 mRNA Translation: AAH29408.1
CCDSiCCDS1827.1 [Q07326-1]
CCDS1828.1 [Q07326-2]
PIRiA46097
RefSeqiNP_002634.1, NM_002643.3 [Q07326-1]
NP_775097.1, NM_173074.2 [Q07326-2]
UniGeneiHs.468415

3D structure databases

ProteinModelPortaliQ07326
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ07326, 5 interactors
STRINGi9606.ENSP00000281382

Polymorphism and mutation databases

BioMutaiPIGF
DMDMi730326

Proteomic databases

PaxDbiQ07326
PRIDEiQ07326
ProteomicsDBi58510
58511 [Q07326-2]

Protocols and materials databases

DNASUi5281
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281382; ENSP00000281382; ENSG00000151665 [Q07326-1]
ENST00000306465; ENSP00000302663; ENSG00000151665 [Q07326-2]
GeneIDi5281
KEGGihsa:5281
UCSCiuc002rvc.4 human [Q07326-1]

Organism-specific databases

CTDi5281
DisGeNETi5281
EuPathDBiHostDB:ENSG00000151665.12
GeneCardsiPIGF
HGNCiHGNC:8962 PIGF
HPAiHPA051389
MIMi600153 gene
neXtProtiNX_Q07326
OpenTargetsiENSG00000151665
PharmGKBiPA33293
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3144 Eukaryota
ENOG4111B1J LUCA
GeneTreeiENSGT00390000016617
HOGENOMiHOG000082526
HOVERGENiHBG031820
InParanoidiQ07326
KOiK05287
OMAiWPISCSL
OrthoDBiEOG091G0HMT
PhylomeDBiQ07326
TreeFamiTF323878

Enzyme and pathway databases

UniPathwayi
UPA00196

ReactomeiR-HSA-162710 Synthesis of glycosylphosphatidylinositol (GPI)

Miscellaneous databases

ChiTaRSiPIGF human
GeneWikiiPIGF
GenomeRNAii5281
PROiPR:Q07326
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151665 Expressed in 207 organ(s), highest expression level in oocyte
CleanExiHS_PIGF
ExpressionAtlasiQ07326 baseline and differential
GenevisibleiQ07326 HS

Family and domain databases

InterProiView protein in InterPro
IPR009580 GPI_biosynthesis_protein_Pig-F
PfamiView protein in Pfam
PF06699 PIG-F, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPIGF_HUMAN
AccessioniPrimary (citable) accession number: Q07326
Secondary accession number(s): Q8WW20
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: November 7, 2018
This is version 144 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again