Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (18 Sep 2019)
Sequence version 2 (11 Jul 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Raf homolog serine/threonine-protein kinase

Gene

lin-45

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein kinase that participates in the induction of vulva and has roles in fertility and viability. Acts downstream of the Ras protein let-60 (PubMed:8483497, PubMed:11861555, PubMed:14724126). Required for progression of developing oocytes through the pachytene stage (PubMed:19826475). Plays a role in responses to M.nematophilum-mediated bacterial infection by promoting tail swelling and preventing constipation (PubMed:15268855). Positively regulates lifespan upstream of mek-2 and mpk-1 (PubMed:20624915).5 Publications

Miscellaneous

Gld-1 binds to the 3'-UTR of lin-45 mRNA and is able to protect nonsense-containing lin-45 mRNA from nonsense mediated decay (NMD).

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 2 Zn2+ ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi184Zinc 2By similarity1
Metal bindingi187Zinc 2By similarity1
Metal bindingi198Zinc 1By similarity1
Metal bindingi201Zinc 1By similarity1
Metal bindingi206Zinc 2By similarity1
Metal bindingi209Zinc 2By similarity1
Metal bindingi217Zinc 1By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei507ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei602Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri170 – 217Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST48
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi487 – 495ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Kinase, Serine/threonine-protein kinase, Transferase
Biological processDifferentiation, Meiosis, Oogenesis
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-2672351 Stimuli-sensing channels
R-CEL-392517 Rap1 signalling
R-CEL-430116 GP1b-IX-V activation signalling
R-CEL-5621575 CD209 (DC-SIGN) signaling
R-CEL-5673000 RAF activation
R-CEL-5674135 MAP2K and MAPK activation
R-CEL-5674499 Negative feedback regulation of MAPK pathway
R-CEL-5675221 Negative regulation of MAPK pathway

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q07292

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Raf homolog serine/threonine-protein kinase (EC:2.7.11.1)
Alternative name(s):
Abnormal cell lineage protein 45
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:lin-45
Synonyms:raf-1
ORF Names:Y73B6A.5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
Y73B6A.5a ; CE25585 ; WBGene00003030 ; lin-45
Y73B6A.5b ; CE49395 ; WBGene00003030 ; lin-45

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown causes a defect in pachytene progression resulting in a proximal gonad devoid of nuclei. The phenotype is more severe in gck-1 (km15) mutant (PubMed:19826475). RNAi-mediated knockdown in adults decreases lifespan (PubMed:20624915).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi92P → S in n2018; 76% larval lethal, 24% abnormal vulval development. 1 Publication1
Mutagenesisi108R → W in n1925; no effect. 1 Publication1
Mutagenesisi118R → W in n2506; 86% larval lethal, 93% abnormal vulval development. 1 Publication1
Mutagenesisi312S → A: Probably abolishes phosphorylation. Multivulva formation. Multivulva formation; when associated with A-453. 1 Publication1
Mutagenesisi453S → A: Probably abolishes phosphorylation. Multivulva formation; when associated with A-312. 1 Publication1
Mutagenesisi645S → N in oz178 and oz201; 55% larval lethal, 100% abnormal vulval development. 1 Publication1
Mutagenesisi726I → F in n1924; 5% larval lethal, no effect on vulval development. 1 Publication1
Mutagenesisi754S → F in n2520 and n2523; no effect. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000861931 – 813Raf homolog serine/threonine-protein kinaseAdd BLAST813

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q07292

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q07292

PeptideAtlas

More...
PeptideAtlasi
Q07292

PRoteomics IDEntifications database

More...
PRIDEi
Q07292

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q07292

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00003030 Expressed in 5 organ(s), highest expression level in material anatomical entity

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q07292 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with cdf-1 in a zinc-dependent manner which promotes its activity.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
42556, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q07292, 4 interactors

STRING: functional protein association networks

More...
STRINGi
6239.Y73B6A.5a.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q07292

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini85 – 161RBDPROSITE-ProRule annotationAdd BLAST77
Domaini481 – 748Protein kinasePROSITE-ProRule annotationAdd BLAST268

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri170 – 217Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0193 Eukaryota
ENOG410Y4UP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000173714

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000252972

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q07292

Database of Orthologous Groups

More...
OrthoDBi
243095at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q07292

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029 C1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR002219 PE/DAG-bd
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR003116 RBD_dom
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008271 Ser/Thr_kinase_AS
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00130 C1_1, 1 hit
PF07714 Pkinase_Tyr, 1 hit
PF02196 RBD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109 C1, 1 hit
SM00455 RBD, 1 hit
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236 SSF54236, 1 hit
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
PS50898 RBD, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform a (identifier: Q07292-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRINFKKSS ASTTPTSPHC PSPRLISLPR CASSSIDRKD QASPMASPST
60 70 80 90 100
PLYPKHSDSL HSLSGHHSAG GAGTSDKEPP KFKYKMIMVH LPFDQHSRVE
110 120 130 140 150
VRPGETARDA ISKLLKKRNI TPQLCHVNAS SDPKQESIEL SLTMEEIASR
160 170 180 190 200
LPGNELWVHS EYLNTVSSIK HAIVRRTFIP PKSCDVCNNP IWMMGFRCEF
210 220 230 240 250
CQFKFHQRCS SFAPLYCDLL QSVPKNEDLV KELFGIASQV EGPDRSVAEI
260 270 280 290 300
VLANLAPTSG QSPAATPDSS HPDLTSIKRT GGVKRHPMAV SPQNETSQLS
310 320 330 340 350
PSGPYPRDRS SSAPNINAIN DEATVQHNQR ILDALEAQRL EEESRDKTGS
360 370 380 390 400
LLSTQARHRP HFQSGHILSG ARMNRLHPLV DCTPLGSNSP SSTCSSPPGG
410 420 430 440 450
LIGQPTLGQS PNVSGSTTSS LVAAHLHTLP LTPPQSAPPQ KISPGFFRNR
460 470 480 490 500
SRSPGERLDA QRPRPPQKPH HEDWEILPNE FIIQYKVGSG SFGTVYRGEF
510 520 530 540 550
FGTVAIKKLN VVDPTPSQMA AFKNEVAVLK KTRHLNVLLF MGWVREPEIA
560 570 580 590 600
IITQWCEGSS LYRHIHVQEP RVEFEMGAII DILKQVSLGM NYLHSKNIIH
610 620 630 640 650
RDLKTNNIFL MDDMSTVKIG DFGLATVKTK WTVNGGQQQQ QPTGSILWMA
660 670 680 690 700
PEVIRMQDDN PYTPQSDVYS FGICMYEILS SHLPYSNINN RDQILFMVGR
710 720 730 740 750
GYLRPDRSKI RHDTPKSMLK LYDNCIMFDR NERPVFGEVL ERLRDIILPK
760 770 780 790 800
LTRSQSAPNV LHLDSQYSVM DAVMRSQMLS WSYIPPATAK TPQSAAAAAA
810
ANKKAYYNVY GLI
Length:813
Mass (Da):90,407
Last modified:July 11, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6376E968D11A9E49
GO
Isoform b (identifier: Q07292-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSAMAVLYSVCHFHGGWNRRKSAPKSPVTSSQTPSSSSTRRRM
     569-572: EPRV → GDLN
     573-813: Missing.

Note: No experimental confirmation available.
Show »
Length:614
Mass (Da):67,499
Checksum:i3AAD690DE18B966B
GO
Isoform c (identifier: Q07292-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: Missing.

Show »
Length:769
Mass (Da):85,681
Checksum:iCF8EF397C584F445
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V6CJK3V6CJK3_CAEEL
Raf homolog serine/threonine-protei...
lin-45 CELE_Y73B6A.5, Y73B6A.5
798Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CKR7V6CKR7_CAEEL
Raf homolog serine/threonine-protei...
lin-45 CELE_Y73B6A.5, Y73B6A.5
838Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CM34V6CM34_CAEEL
Raf homolog serine/threonine-protei...
lin-45 CELE_Y73B6A.5, Y73B6A.5
769Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V6CM38V6CM38_CAEEL
Raf homolog serine/threonine-protei...
lin-45 CELE_Y73B6A.5, Y73B6A.5
781Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti801A → R in AAA28142 (PubMed:8483497).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0206211 – 44Missing in isoform c. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0206201M → MSAMAVLYSVCHFHGGWNRR KSAPKSPVTSSQTPSSSSTR RRM in isoform b. Curated1
Alternative sequenceiVSP_020622569 – 572EPRV → GDLN in isoform b. Curated4
Alternative sequenceiVSP_020623573 – 813Missing in isoform b. CuratedAdd BLAST241

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L15347 mRNA Translation: AAA28142.1
AY455928 mRNA Translation: AAR26307.1
AY493413 mRNA Translation: AAR86712.1
AY493414 mRNA Translation: AAR86713.1
FO080249 Genomic DNA Translation: CCD62343.1
FO080249 Genomic DNA Translation: CCD62344.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S33261

NCBI Reference Sequences

More...
RefSeqi
NP_001293844.1, NM_001306915.1 [Q07292-3]
NP_741430.3, NM_171367.5 [Q07292-1]
NP_741431.2, NM_171368.2

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
Y73B6A.5a.1; Y73B6A.5a.1; WBGene00003030 [Q07292-1]
Y73B6A.5b.1; Y73B6A.5b.1; WBGene00003030

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
177436

UCSC genome browser

More...
UCSCi
Y73B6A.5a.1 c. elegans [Q07292-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L15347 mRNA Translation: AAA28142.1
AY455928 mRNA Translation: AAR26307.1
AY493413 mRNA Translation: AAR86712.1
AY493414 mRNA Translation: AAR86713.1
FO080249 Genomic DNA Translation: CCD62343.1
FO080249 Genomic DNA Translation: CCD62344.1
PIRiS33261
RefSeqiNP_001293844.1, NM_001306915.1 [Q07292-3]
NP_741430.3, NM_171367.5 [Q07292-1]
NP_741431.2, NM_171368.2

3D structure databases

SMRiQ07292
ModBaseiSearch...

Protein-protein interaction databases

BioGridi42556, 18 interactors
IntActiQ07292, 4 interactors
STRINGi6239.Y73B6A.5a.1

PTM databases

iPTMnetiQ07292

Proteomic databases

EPDiQ07292
PaxDbiQ07292
PeptideAtlasiQ07292
PRIDEiQ07292

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiY73B6A.5a.1; Y73B6A.5a.1; WBGene00003030 [Q07292-1]
Y73B6A.5b.1; Y73B6A.5b.1; WBGene00003030
GeneIDi177436
UCSCiY73B6A.5a.1 c. elegans [Q07292-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
177436
WormBaseiY73B6A.5a ; CE25585 ; WBGene00003030 ; lin-45
Y73B6A.5b ; CE49395 ; WBGene00003030 ; lin-45

Phylogenomic databases

eggNOGiKOG0193 Eukaryota
ENOG410Y4UP LUCA
GeneTreeiENSGT00940000173714
HOGENOMiHOG000252972
InParanoidiQ07292
OrthoDBi243095at2759
PhylomeDBiQ07292

Enzyme and pathway databases

ReactomeiR-CEL-2672351 Stimuli-sensing channels
R-CEL-392517 Rap1 signalling
R-CEL-430116 GP1b-IX-V activation signalling
R-CEL-5621575 CD209 (DC-SIGN) signaling
R-CEL-5673000 RAF activation
R-CEL-5674135 MAP2K and MAPK activation
R-CEL-5674499 Negative feedback regulation of MAPK pathway
R-CEL-5675221 Negative regulation of MAPK pathway
SignaLinkiQ07292

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q07292

Gene expression databases

BgeeiWBGene00003030 Expressed in 5 organ(s), highest expression level in material anatomical entity
ExpressionAtlasiQ07292 baseline and differential

Family and domain databases

CDDicd00029 C1, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR002219 PE/DAG-bd
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR003116 RBD_dom
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008271 Ser/Thr_kinase_AS
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF07714 Pkinase_Tyr, 1 hit
PF02196 RBD, 1 hit
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00455 RBD, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
PS50898 RBD, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKRAF1_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q07292
Secondary accession number(s): Q6RT23, Q8MXT8, Q9N4E3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: July 11, 2002
Last modified: September 18, 2019
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again