Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 18

Gene

CDK18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in signal transduction cascades in terminally differentiated cells.

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei173ATPPROSITE-ProRule annotation1
Active sitei265Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi150 – 158ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22 2681
SignaLinkiQ07002

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 18 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 18
PCTAIRE-motif protein kinase 3
Serine/threonine-protein kinase PCTAIRE-3
Gene namesi
Name:CDK18
Synonyms:PCTAIRE3, PCTK3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000117266.15
HGNCiHGNC:8751 CDK18
MIMi169190 gene
neXtProtiNX_Q07002

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi5129
OpenTargetsiENSG00000117266
PharmGKBiPA33097

Chemistry databases

ChEMBLiCHEMBL5316
GuidetoPHARMACOLOGYi1971

Polymorphism and mutation databases

DMDMi116242704

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000864901 – 474Cyclin-dependent kinase 18Add BLAST474

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14PhosphoserineCombined sources1
Modified residuei74PhosphoserineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei117PhosphoserineCombined sources1
Modified residuei132PhosphoserineCombined sources1
Modified residuei440PhosphoserineBy similarity1
Modified residuei443PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ07002
PeptideAtlasiQ07002
PRIDEiQ07002
ProteomicsDBi58495
58496 [Q07002-2]
58497 [Q07002-3]

PTM databases

iPTMnetiQ07002
PhosphoSitePlusiQ07002

Expressioni

Tissue specificityi

Isoform 2 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 1 is widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000117266
CleanExiHS_PCTK3
ExpressionAtlasiQ07002 baseline and differential
GenevisibleiQ07002 HS

Organism-specific databases

HPAiHPA045429

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi111156, 63 interactors
IntActiQ07002, 84 interactors
MINTiQ07002

Chemistry databases

BindingDBiQ07002

Structurei

3D structure databases

ProteinModelPortaliQ07002
SMRiQ07002
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini144 – 425Protein kinasePROSITE-ProRule annotationAdd BLAST282

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00900000140869
HOGENOMiHOG000233024
HOVERGENiHBG014652
InParanoidiQ07002
KOiK15596
OMAiQYLDNCG
OrthoDBiEOG091G0CH0
PhylomeDBiQ07002
TreeFamiTF106508

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q07002-2) [UniParc]FASTAAdd to basket
Also known as: 3a1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIMNKMKNFK RRFSLSVPRT ETIEESLAEF TEQFNQLHNR RNENLQLGPL
60 70 80 90 100
GRDPPQECST FSPTDSGEEP GQLSPGVQFQ RRQNQRRFSM EDVSKRLSLP
110 120 130 140 150
MDIRLPQEFL QKLQMESPDL PKPLSRMSRR ASLSDIGFGK LETYVKLDKL
160 170 180 190 200
GEGTYATVFK GRSKLTENLV ALKEIRLEHE EGAPCTAIRE VSLLKNLKHA
210 220 230 240 250
NIVTLHDLIH TDRSLTLVFE YLDSDLKQYL DHCGNLMSMH NVKIFMFQLL
260 270 280 290 300
RGLAYCHHRK ILHRDLKPQN LLINERGELK LADFGLARAK SVPTKTYSNE
310 320 330 340 350
VVTLWYRPPD VLLGSTEYST PIDMWGVGCI HYEMATGRPL FPGSTVKEEL
360 370 380 390 400
HLIFRLLGTP TEETWPGVTA FSEFRTYSFP CYLPQPLINH APRLDTDGIH
410 420 430 440 450
LLSSLLLYES KSRMSAEAAL SHSYFRSLGE RVHQLEDTAS IFSLKEIQLQ
460 470
KDPGYRGLAF QQPGRGKNRR QSIF
Length:474
Mass (Da):54,424
Last modified:March 28, 2018 - v4
Checksum:i43C83A573A595476
GO
Isoform 2 (identifier: Q07002-3) [UniParc]FASTAAdd to basket
Also known as: 3b1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     91-91: E → EVRASGALPRQVAGCTHKGVHRRAAALQPDF

Show »
Length:504
Mass (Da):57,577
Checksum:i174DA12243EDE359
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti258H → T in CAA47005 (PubMed:1639063).Curated1
Sequence conflicti323D → A in CAA47005 (PubMed:1639063).Curated1
Sequence conflicti407L → V in CAA47005 (PubMed:1639063).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04780248G → S1 PublicationCorresponds to variant dbSNP:rs35134237Ensembl.1
Natural variantiVAR_04780367G → R1 PublicationCorresponds to variant dbSNP:rs4623769Ensembl.1
Natural variantiVAR_047804166T → M3 PublicationsCorresponds to variant dbSNP:rs17850752Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03588991E → EVRASGALPRQVAGCTHKGV HRRAAALQPDF in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY353237 mRNA Translation: AAR13065.1
AY353238 mRNA Translation: AAR13066.1
BT007299 mRNA Translation: AAP35963.1
AL357131 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91559.1
CH471067 Genomic DNA Translation: EAW91560.1
BC011526 mRNA Translation: AAH11526.1
X66362 mRNA Translation: CAA47005.1
CCDSiCCDS1454.1 [Q07002-3]
CCDS44300.1 [Q07002-2]
PIRiS32831
RefSeqiNP_002587.2, NM_002596.3 [Q07002-2]
NP_997667.1, NM_212502.2 [Q07002-2]
NP_997668.1, NM_212503.2 [Q07002-3]
UniGeneiHs.445402

Genome annotation databases

EnsembliENST00000360066; ENSP00000353176; ENSG00000117266 [Q07002-2]
ENST00000429964; ENSP00000399082; ENSG00000117266 [Q07002-2]
ENST00000506784; ENSP00000423665; ENSG00000117266 [Q07002-3]
GeneIDi5129
KEGGihsa:5129
UCSCiuc001hcp.4 human [Q07002-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCDK18_HUMAN
AccessioniPrimary (citable) accession number: Q07002
Secondary accession number(s): Q5VXQ2
, Q6V3A2, Q6V3A3, Q96F90
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: March 28, 2018
Last modified: July 18, 2018
This is version 186 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health