Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (02 Jun 2021)
Sequence version 2 (23 Apr 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Basement membrane proteoglycan

Gene

unc-52

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of an integrin containing attachment complex, which is required for muscle development and maintenance (PubMed:22253611).

Probable structural role in myofilament assembly and/or attachment of the myofilament lattice to the cell membrane (PubMed:8393416, PubMed:11438655, PubMed:17326220).

May be an extracellular anchor for integrin receptors in body wall muscles and myoepithelial sheath cells (PubMed:8393416, PubMed:17326220).

During the formation of neuromuscular junctions at the larval stage, negatively regulates membrane protrusion from body wall muscles, probably downstream of the integrin complex formed by pat-2 and pat-3 (PubMed:16495308).

Involved in ovulation (PubMed:17326220).

5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • extracellular matrix structural constituent Source: WormBase

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1474228, Degradation of the extracellular matrix
R-CEL-1971475, A tetrasaccharide linker sequence is required for GAG synthesis
R-CEL-2022928, HS-GAG biosynthesis
R-CEL-2024096, HS-GAG degradation
R-CEL-3000157, Laminin interactions
R-CEL-3000171, Non-integrin membrane-ECM interactions
R-CEL-3000178, ECM proteoglycans

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Basement membrane proteoglycan1 Publication
Alternative name(s):
Perlecan homolog1 Publication
Uncoordinated protein 52
Short name:
Protein unc-522 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:unc-52Imported
ORF Names:ZC101.2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome II

Organism-specific databases

WormBase

More...
WormBasei
ZC101.2a ; CE15028 ; WBGene00006787 ; unc-52
ZC101.2b ; CE15030 ; WBGene00006787 ; unc-52
ZC101.2c ; CE15034 ; WBGene00006787 ; unc-52
ZC101.2e ; CE18424 ; WBGene00006787 ; unc-52
ZC101.2f ; CE37074 ; WBGene00006787 ; unc-52

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Basement membrane, Cytoplasm, Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown in L4 larval stage, causes a small increase in ectopic membrane extensions from body wall muscles (PubMed:16495308). RNAi-mediated knockdown causes an accumulation in the proximal gonad of endomitotic mature oocytes in 30 percent of animals (PubMed:17326220). RNAi-mediated knockdown results in impaired mobility, mitochondrial fragmentation, and disrupted integrin attachment complexes in muscle (PubMed:22253611). This leads to degradation of muscle proteins in the cytosol, myofibrillar defects and disruption of sarcomere organization (PubMed:22253611).3 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002669823 – 3375Basement membrane proteoglycanAdd BLAST3353

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi66 ↔ 114PROSITE-ProRule annotation
Disulfide bondi149 ↔ 161PROSITE-ProRule annotation
Disulfide bondi156 ↔ 174PROSITE-ProRule annotation
Disulfide bondi168 ↔ 183PROSITE-ProRule annotation
Disulfide bondi190 ↔ 202PROSITE-ProRule annotation
Disulfide bondi197 ↔ 215PROSITE-ProRule annotation
Disulfide bondi209 ↔ 224PROSITE-ProRule annotation
Disulfide bondi233 ↔ 246PROSITE-ProRule annotation
Disulfide bondi240 ↔ 259PROSITE-ProRule annotation
Disulfide bondi253 ↔ 268PROSITE-ProRule annotation
Disulfide bondi293 ↔ 344PROSITE-ProRule annotation
Disulfide bondi384 ↔ 400PROSITE-ProRule annotation
Disulfide bondi402 ↔ 411PROSITE-ProRule annotation
Disulfide bondi414 ↔ 429PROSITE-ProRule annotation
Disulfide bondi634 ↔ 648PROSITE-ProRule annotation
Disulfide bondi636 ↔ 689PROSITE-ProRule annotation
Disulfide bondi691 ↔ 700PROSITE-ProRule annotation
Disulfide bondi703 ↔ 718PROSITE-ProRule annotation
Disulfide bondi955 ↔ 964PROSITE-ProRule annotation
Disulfide bondi957 ↔ 971PROSITE-ProRule annotation
Disulfide bondi974 ↔ 983PROSITE-ProRule annotation
Disulfide bondi986 ↔ 1002PROSITE-ProRule annotation
Disulfide bondi1011 ↔ 1021PROSITE-ProRule annotation
Disulfide bondi1013 ↔ 1027PROSITE-ProRule annotation
Disulfide bondi1030 ↔ 1039PROSITE-ProRule annotation
Disulfide bondi1042 ↔ 1058PROSITE-ProRule annotation
Disulfide bondi1061 ↔ 1069PROSITE-ProRule annotation
Disulfide bondi1063 ↔ 1079PROSITE-ProRule annotation
Disulfide bondi1082 ↔ 1091PROSITE-ProRule annotation
Disulfide bondi1094 ↔ 1109PROSITE-ProRule annotation
Disulfide bondi1152 ↔ 1200PROSITE-ProRule annotation
Disulfide bondi1247 ↔ 1294PROSITE-ProRule annotation
Disulfide bondi1338 ↔ 1384PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi1422N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi1435 ↔ 1481PROSITE-ProRule annotation
Disulfide bondi1527 ↔ 1573PROSITE-ProRule annotation
Disulfide bondi1618 ↔ 1663PROSITE-ProRule annotation
Disulfide bondi1719 ↔ 1767PROSITE-ProRule annotation
Disulfide bondi1814 ↔ 1861PROSITE-ProRule annotation
Disulfide bondi1907 ↔ 1954PROSITE-ProRule annotation
Disulfide bondi1998 ↔ 2053PROSITE-ProRule annotation
Disulfide bondi2099 ↔ 2147PROSITE-ProRule annotation
Disulfide bondi2195 ↔ 2242PROSITE-ProRule annotation
Disulfide bondi2284 ↔ 2329PROSITE-ProRule annotation
Disulfide bondi2374 ↔ 2420PROSITE-ProRule annotation
Disulfide bondi2467 ↔ 2514PROSITE-ProRule annotation
Glycosylationi2476N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi2713 ↔ 2725PROSITE-ProRule annotation
Disulfide bondi2719 ↔ 2736PROSITE-ProRule annotation
Disulfide bondi2738 ↔ 2747PROSITE-ProRule annotation
Disulfide bondi2754 ↔ 2764PROSITE-ProRule annotation
Disulfide bondi2759 ↔ 2773PROSITE-ProRule annotation
Disulfide bondi2775 ↔ 2784PROSITE-ProRule annotation
Disulfide bondi2935 ↔ 2960PROSITE-ProRule annotation
Glycosylationi2950N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi3141 ↔ 3152PROSITE-ProRule annotation
Glycosylationi3143N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi3146 ↔ 3162PROSITE-ProRule annotation
Glycosylationi3156N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi3164 ↔ 3173PROSITE-ProRule annotation
Disulfide bondi3333 ↔ 3359PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Proteoglycan

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q06561

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q06561

PeptideAtlas

More...
PeptideAtlasi
Q06561

PRoteomics IDEntifications database

More...
PRIDEi
Q06561

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q06561

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected on embryonic and adult body wall muscle cells (at protein level) (PubMed:8393416, PubMed:10512861). Found in the basement membrane of all contractile tissues (at protein level) (PubMed:10512861). Expressed in gonadal sheath cells and spermatheca (PubMed:17326220).3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Synthesized early in embryogenesis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006787, Expressed in material anatomical entity and 4 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q06561, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of an integrin containing attachment complex, composed of at least pat-2, pat-3, pat-4, pat-6, unc-52, unc-97 and unc-112.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
40407, 19 interactors

Protein interaction database and analysis system

More...
IntActi
Q06561, 1 interactor

STRING: functional protein association networks

More...
STRINGi
6239.ZC101.2e

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 130Ig-like C2-type 1Add BLAST86
Domaini148 – 184LDL-receptor class A 1PROSITE-ProRule annotationAdd BLAST37
Domaini189 – 225LDL-receptor class A 2PROSITE-ProRule annotationAdd BLAST37
Domaini232 – 269LDL-receptor class A 3PROSITE-ProRule annotationAdd BLAST38
Domaini271 – 355Ig-like C2-type 2Add BLAST85
Domaini384 – 431Laminin EGF-like 1; truncatedPROSITE-ProRule annotationAdd BLAST48
Domaini432 – 441Laminin EGF-like 2; first partPROSITE-ProRule annotation10
Domaini450 – 633Laminin IV type A 1PROSITE-ProRule annotationAdd BLAST184
Domaini634 – 666Laminin EGF-like 2; second partPROSITE-ProRule annotationAdd BLAST33
Domaini674 – 720Laminin EGF-like 3; truncatedPROSITE-ProRule annotationAdd BLAST47
Domaini721 – 730Laminin EGF-like 4; first partPROSITE-ProRule annotation10
Domaini740 – 921Laminin IV type A 2PROSITE-ProRule annotationAdd BLAST182
Domaini922 – 954Laminin EGF-like 4; second partPROSITE-ProRule annotationAdd BLAST33
Domaini955 – 1004Laminin EGF-like 5PROSITE-ProRule annotationAdd BLAST50
Domaini1011 – 1060Laminin EGF-like 6PROSITE-ProRule annotationAdd BLAST50
Domaini1061 – 1111Laminin EGF-like 7PROSITE-ProRule annotationAdd BLAST51
Domaini1126 – 1222Ig-like C2-type 3Add BLAST97
Domaini1226 – 1311Ig-like C2-type 4Add BLAST86
Domaini1319 – 1401Ig-like C2-type 5Add BLAST83
Domaini1410 – 1499Ig-like C2-type 6Add BLAST90
Domaini1503 – 1585Ig-like C2-type 7Add BLAST83
Domaini1588 – 1680Ig-like C2-type 8Add BLAST93
Domaini1690 – 1785Ig-like C2-type 9Add BLAST96
Domaini1793 – 1878Ig-like C2-type 10Add BLAST86
Domaini1886 – 1970Ig-like C2-type 11Add BLAST85
Domaini1973 – 2069Ig-like C2-type 12Add BLAST97
Domaini2073 – 2163Ig-like C2-type 13Add BLAST91
Domaini2173 – 2260Ig-like C2-type 14Add BLAST88
Domaini2263 – 2343Ig-like C2-type 15Add BLAST81
Domaini2349 – 2435Ig-like C2-type 16Add BLAST87
Domaini2446 – 2530Ig-like C2-type 17Add BLAST85
Domaini2532 – 2713Laminin G-like 1PROSITE-ProRule annotationAdd BLAST182
Domaini2793 – 2960Laminin G-like 2PROSITE-ProRule annotationAdd BLAST168
Domaini3180 – 3359Laminin G-like 3PROSITE-ProRule annotationAdd BLAST180

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni364 – 385DisorderedSequence analysisAdd BLAST22
Regioni1388 – 1426DisorderedSequence analysisAdd BLAST39
Regioni1478 – 1497DisorderedSequence analysisAdd BLAST20
Regioni1773 – 1792DisorderedSequence analysisAdd BLAST20
Regioni1880 – 1918DisorderedSequence analysisAdd BLAST39
Regioni2952 – 3124DisorderedSequence analysisAdd BLAST173

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1483 – 1497Polar residuesSequence analysisAdd BLAST15
Compositional biasi1773 – 1789Polar residuesSequence analysisAdd BLAST17
Compositional biasi2984 – 3013Acidic residuesSequence analysisAdd BLAST30
Compositional biasi3014 – 3036Polar residuesSequence analysisAdd BLAST23
Compositional biasi3052 – 3069Polar residuesSequence analysisAdd BLAST18
Compositional biasi3094 – 3120Polar residuesSequence analysisAdd BLAST27

Keywords - Domaini

Immunoglobulin domain, Laminin EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3509, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000078_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q06561

Identification of Orthologs from Complete Genome Data

More...
OMAi
RCQYIEH

Database of Orthologous Groups

More...
OrthoDBi
414294at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q06561

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112, LDLa, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 17 hits
4.10.400.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320, ConA-like_dom_sf
IPR001881, EGF-like_Ca-bd_dom
IPR000742, EGF-like_dom
IPR009030, Growth_fac_rcpt_cys_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR002049, Laminin_EGF
IPR001791, Laminin_G
IPR000034, Laminin_IV
IPR036055, LDL_receptor-like_sf
IPR023415, LDLR_class-A_CS
IPR002172, LDrepeatLR_classA_rpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679, I-set, 2 hits
PF13895, Ig_2, 2 hits
PF00052, Laminin_B, 2 hits
PF00053, Laminin_EGF, 7 hits
PF02210, Laminin_G_2, 3 hits
PF00057, Ldl_recept_a, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00261, LDLRECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181, EGF, 6 hits
SM00179, EGF_CA, 2 hits
SM00180, EGF_Lam, 6 hits
SM00409, IG, 17 hits
SM00408, IGc2, 17 hits
SM00281, LamB, 2 hits
SM00282, LamG, 3 hits
SM00192, LDLa, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 15 hits
SSF49899, SSF49899, 3 hits
SSF57184, SSF57184, 1 hit
SSF57424, SSF57424, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022, EGF_1, 7 hits
PS01186, EGF_2, 2 hits
PS50026, EGF_3, 3 hits
PS01248, EGF_LAM_1, 7 hits
PS50027, EGF_LAM_2, 5 hits
PS50835, IG_LIKE, 17 hits
PS50025, LAM_G_DOMAIN, 3 hits
PS51115, LAMININ_IVA, 2 hits
PS01209, LDLRA_1, 3 hits
PS50068, LDLRA_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform eImported (identifier: Q06561-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRSSTVLAA LLALLLVATN DAARHRKYRQ TYQDIDSDDD DTSDVQITVF
60 70 80 90 100
PSEKEVRDGR DVSFECRART SDNSVYPTVR WARVGGPLPS SAHDSGGRLT
110 120 130 140 150
INPVQLSDAG TYICVSDYNG NTVEARATLS VVSYGPQEVS NGLRQAGQCM
160 170 180 190 200
ADEKACGNNE CVKNDYVCDG EPDCRDRSDE ANCPAISRTC EPNEFKCNNN
210 220 230 240 250
KCVQKMWLCD GDDDCGDNSD ELNCNAKPSS SDCKPTEFQC HDRRQCVPSS
260 270 280 290 300
FHCDGTNDCH DGSDEVGCVQ PTVVDPPQTN LQVPRGTTFS LTCKAVAVPE
310 320 330 340 350
PYINWRLNWG PVCEPPRCLQ TSEGGYGTLT IHDAQPVDQG AYTCEAINVK
360 370 380 390 400
GRVLATPDCI VRVVDDPRPQ PPQPPTAPPQ RASCDTRGAV TPYPNNYGTC
410 420 430 440 450
ECKSQVTGPN CDQCKPGAFH LSEKSPEGCL KCFCFGVSND CRSSGHYRTK
460 470 480 490 500
DRLMFAGDAE GVTISDIEER TIDRNTPFSF FKTGYLTFDG TTDGVAKYWR
510 520 530 540 550
LPQRFLGDKV TAYGGKMEFE IEFSGSGHHS SEPMVVLKGN QNILVHRVRN
560 570 580 590 600
QEHVLRSDSP VRITVETYET NYEQLNGAAA TREDLLMVLA DLDAFLIRAT
610 620 630 640 650
HVAHQTSTSL GDVSWEIAVD RYTPDGLALE VEQCVCPPGY LGTSCEDCAP
660 670 680 690 700
GYERSGYGPY LGTCVPIQPR HQQCGPGAVA PTAPAQGQCQ CKASVIGPNC
710 720 730 740 750
DRCAPNSFGL APTNPQGCIP CFCSGVTQQC SASSYRRTSV SIDYARGDRD
760 770 780 790 800
QLELTTSDSR QPYSPQTRAE LSGQAIEFRS FEEARGQTLY WKLPEKFLGD
810 820 830 840 850
KVTSYGGTLE YTFKFSGNGN SDQSADVILR GNDIALQYKH REPFYADREN
860 870 880 890 900
KVQIKIIETS WQRVDGQQAT REHLLMTLAD LDTLLIKSTY NDDCTDSQLL
910 920 930 940 950
SANLEFAEPY GQGLTAAEVE QCICPPGYVG TSCEDCAPGY SRTGGGLYLG
960 970 980 990 1000
LCEKCECNGH ASQCDKEYGY CLDCQHNTEG DQCERCKPGF VGDARRGTPN
1010 1020 1030 1040 1050
DCQPEATRAP CHCNNHSPRG CDSFGRCLLC EHNTEGTHCE RCKKGYYGDA
1060 1070 1080 1090 1100
TKGSPYDCTP CPCPGASDCY LDNEGQVACR ICPAGLQGRL CNECAPGYTR
1110 1120 1130 1140 1150
SNKPAGRVCE PIGQVTNEDI TFVQKPHEVL RVRIMEPKRQ IALPGDRVHW
1160 1170 1180 1190 1200
ICQVTGYTTE KIHVEWTKVG EMSLPPNAKA YDGYLVLKGV EAENAGQYRC
1210 1220 1230 1240 1250
TATTITQYAT DDALLTISKR ISGRPPQPVI DPPHLVVNEG EPAAFRCWVP
1260 1270 1280 1290 1300
GIPDCQITWH REQLGGPLPH GVYQTGNALK IPQSQLHHAG RYICSAANQY
1310 1320 1330 1340 1350
GTGQSPPAVL EVKKPVIPPK VDPIRQTVDR DQPARFKCWV PGNSNVQLRW
1360 1370 1380 1390 1400
SRPGGAPLPS GVQEQQGILH IPRASDQEVG QYVCTATDPS DNTPLQSEPV
1410 1420 1430 1440 1450
QLNIRDPAPP QRGAAPQIDP PNQTVNVNDP AQFRCWVPGQ PRAQLKWSRK
1460 1470 1480 1490 1500
DGRPLPNGIL ERDGFLRIDK SQLHDAGEYE CTSTEPDGST QLSPPARLNV
1510 1520 1530 1540 1550
NQPQAIQPQV DPPVQTVNEG EPSRIRCWVP GHPNIQLQFV KRGRRPLPAH
1560 1570 1580 1590 1600
ARFSQGNLEI PRTLKSDEDE YICIATDPTT NRPVESNPAR VIVKSPIRPI
1610 1620 1630 1640 1650
IDPAEQTVPE GSPFKIRCYV PGHPSVQLTF RRVSGQLNED ADENNGLLAV
1660 1670 1680 1690 1700
QRAELTDEGD YICTARDPDT GAPIDSTPAT VHVTNAAAPP QVEARPPQHP
1710 1720 1730 1740 1750
VITPQTQTIP EGDPARIQCT VPGNPSAAQH LSFERVDGKG LPFGSSDDRG
1760 1770 1780 1790 1800
VLTIPSTQLQ DAGEYVCLYS PENSPPVKTN PSTLNVTPEG TPPRPVATPP
1810 1820 1830 1840 1850
LLSVAPGSPA RFNCVAHSDT PARIRWGFRE ENGPLPEHVN QDGDDIVISE
1860 1870 1880 1890 1900
AGDRNVGEYV CSATNDFGTG VADPVRLEVT EDQEPPTAVV EPRTWNGKPG
1910 1920 1930 1940 1950
ERHQFRCITT GSPTPKITWT GPNGSPLPHD VTPLEPNILD FSNGRSELNG
1960 1970 1980 1990 2000
DYTCTASNPI GEASDHGNVN IGPSLTVKTN PPGPKLIVTV GEPLQVKCEA
2010 2020 2030 2040 2050
FGAPGDPEPE VEWLHDPGPE RGDLPDDFKP VTISEQFIRH PNVGLGNAGV
2060 2070 2080 2090 2100
YTCKGSSAHA TATKNIYIEV VEPSRIATVS ILGGSSQWFD QGEKGELICT
2110 2120 2130 2140 2150
ATGSSLVDRL EWEKVDDQLP TDVEEHNEPG LLHFPSFKNS YAGEYRCNGY
2160 2170 2180 2190 2200
RNNEIIASAA VHVHSSANAD DEPKVEIEPP RVRVVSQGDN IVLKCSVQGA
2210 2220 2230 2240 2250
ENGEHFKWAL LRGGSLVRQL GTEPTLEITK ADPSNDFGVY RCNVEDNNGL
2260 2270 2280 2290 2300
VIGSAFTAVS VGQQDKSHAQ IVKFDDKSDA SFTCPIYSVP GSKVDWTYEN
2310 2320 2330 2340 2350
GDLPSKAVPN GNKIEIKEFD DASAGTYVCK VSFDGNVVEG FVTAQMFVPD
2360 2370 2380 2390 2400
TIIQVLLEVS SESPQIGDRA WFDCKVTGDP SAVISWTKEG NDDLPPNAQV
2410 2420 2430 2440 2450
TGGRLLFTDL KEDNAGVYRC VAKTKAGPLQ TRTVLNVGSG KQDQVTFTVA
2460 2470 2480 2490 2500
DSLPVVYTVG QPAYLSCIGK TETKPNQSVV WTKEEGDLPS GSRVEQGVLM
2510 2520 2530 2540 2550
LPSVHRDDEG SYTCEIVKEE NPVFSTVDLQ IDDFIPVIDG EPIELPPLSD
2560 2570 2580 2590 2600
EEIVNLDIEI TLNTANPKGI IFETKRINSG DLLATPYDTI HHEAKITDYG
2610 2620 2630 2640 2650
TVLYEFDIGN GRQIVETTNP INPNEWNVIK IKNDKNQVTI QLNDESATIR
2660 2670 2680 2690 2700
QHTNPLPSLS TGVNRPVFIG GRHEPTNEAN DFRGIISQVV LSGHNVGLGD
2710 2720 2730 2740 2750
ARIPSSVVKY DACASTNLCL NGANCRNANN HHGFSCECAE EFHGEYCQWR
2760 2770 2780 2790 2800
SNSCHDESCN TGICLDNEES WQCVCPLGTT GLRCEEKTEI PQPLGFTSDT
2810 2820 2830 2840 2850
SFLAVKRPVK FESIKMKLRP QADSDEHILM YFASDYGSNT KQYTSLSLIA
2860 2870 2880 2890 2900
NQVVLTVRRP DKEVQKIRSE TLEAGELIDV AVRQAGNALV MTVDGNQVST
2910 2920 2930 2940 2950
IETDTLKPGT EIFIGGLPPG LNSPDDVVEQ SFQGCVYEIL INSQDVDLQN
2960 2970 2980 2990 3000
LSSSGDISSC EESQFPVEED DTTTTTTTEE PEAVIEEPTT EEPTTTEEPI
3010 3020 3030 3040 3050
TEEPTEEPTT TEEPTTTEEP TTTTEEPTTT TTEEPYHIYE TSRDDDPEII
3060 3070 3080 3090 3100
IPVETTTTST TTTSTTEEPE AEPALVLPTD PVEENDVSDE EEEISTISTV
3110 3120 3130 3140 3150
SPDNGLDSDS DYSEGTLPPD SSSEEIVVGD VYSTQEPNNI CANSTCGMNG
3160 3170 3180 3190 3200
QCVPRNMTHY TCECKLYYDG PTCSLFKPIE HAARFDGDAF IELSSDEFPH
3210 3220 3230 3240 3250
LTSEKDEIVA FKFKTEQQNG VLLWQGQRPT VQQMEDYISV GIVNGHLHFS
3260 3270 3280 3290 3300
YELGGGAAHL ISEERVDDGK EHSVRFERKG REGQMRIDNY REVDGRSTGI
3310 3320 3330 3340 3350
LAMLNVDGNI FVGGVPDISK ATGGLFSNNF VGCIADVELN GVKLDLMATA
3360 3370
IDGKNVKPCD EWMHRKRWLY RRRVR
Length:3,375
Mass (Da):369,052
Last modified:April 23, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1AA418BB4E5D67AA
GO
Isoform aImported (identifier: Q06561-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2442-2482: QDQVTFTVAD...TKPNQSVVWT → RKRKHLGNRR...TTTKLFGSWF
     2483-3375: Missing.

Show »
Length:2,482
Mass (Da):270,945
Checksum:iB24096F7DB694D70
GO
Isoform bImported (identifier: Q06561-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1129-1160: VLRVRIMEPKRQIALPGDRVHWICQVTGYTTE → GDFARNSPSQNSSGQRRHRRRRIRVRSRFYHH
     1161-3375: Missing.

Show »
Length:1,160
Mass (Da):127,379
Checksum:i571A23C709285FC6
GO
Isoform cImported (identifier: Q06561-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1695-1695: R → H
     1696-1882: Missing.
     2442-2482: QDQVTFTVAD...TKPNQSVVWT → RKRKHLGNRR...TTTKLFGSWF
     2483-3375: Missing.

Show »
Length:2,295
Mass (Da):251,089
Checksum:iF6BC6067ABF86C48
GO
Isoform fImported (identifier: Q06561-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1129-1222: VLRVRIMEPK...ALLTISKRIS → G
     2442-2482: QDQVTFTVAD...TKPNQSVVWT → RKRKHLGNRR...TTTKLFGSWF
     2485-3375: Missing.

Show »
Length:2,391
Mass (Da):260,697
Checksum:iF248E1A025D5D5D3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H9G353H9G353_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,196Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G348H9G348_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,383Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G352H9G352_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,193Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G354H9G354_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,289Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G349H9G349_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,388Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G350H9G350_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,479Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G351H9G351_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
2,296Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G1K109G1K109_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
876Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5EEI5G5EEI5_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
4,075Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1T5HUZ1A0A1T5HUZ1_CAEEL
Basement membrane proteoglycan
unc-52 CELE_ZC101.2, ZC101.2
3,271Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti512Missing in AAA28156 (PubMed:8393416).Curated1
Sequence conflicti547R → P in AAA28156 (PubMed:8393416).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0201041129 – 1222VLRVR…SKRIS → G in isoform f. CuratedAdd BLAST94
Alternative sequenceiVSP_0071911129 – 1160VLRVR…GYTTE → GDFARNSPSQNSSGQRRHRR RRIRVRSRFYHH in isoform b. CuratedAdd BLAST32
Alternative sequenceiVSP_0071921161 – 3375Missing in isoform b. CuratedAdd BLAST2215
Alternative sequenceiVSP_0071931695R → H in isoform c. Curated1
Alternative sequenceiVSP_0071941696 – 1882Missing in isoform c. CuratedAdd BLAST187
Alternative sequenceiVSP_0071952442 – 2482QDQVT…SVVWT → RKRKHLGNRRGRRLRHRRRN AQNGPLSRKTRTTTKLFGSW F in isoform a, isoform c and isoform f. CuratedAdd BLAST41
Alternative sequenceiVSP_0071962483 – 3375Missing in isoform a and isoform c. CuratedAdd BLAST893
Alternative sequenceiVSP_0201052485 – 3375Missing in isoform f. CuratedAdd BLAST891

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L13458 Genomic DNA Translation: AAA28156.1
BX284602 Genomic DNA Translation: CAB07704.1
BX284602, Z93375 Genomic DNA Translation: CAB07706.1
BX284602, Z93375 Genomic DNA Translation: CAB07707.1
BX284602, Z93375 Genomic DNA Translation: CAB07708.1
BX284602, Z93375 Genomic DNA Translation: CAH04744.1
AF132883 mRNA Translation: AAD25092.1

Protein sequence database of the Protein Information Resource

More...
PIRi
C88369
F88369
T19821

NCBI Reference Sequences

More...
RefSeqi
NP_001022488.1, NM_001027317.5
NP_497044.3, NM_064643.8 [Q06561-1]
NP_497045.1, NM_064644.3 [Q06561-4]
NP_497046.1, NM_064645.4 [Q06561-2]
NP_497047.1, NM_064646.4 [Q06561-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
ZC101.2a.1; ZC101.2a.1; WBGene00006787 [Q06561-2]
ZC101.2b.1; ZC101.2b.1; WBGene00006787 [Q06561-3]
ZC101.2c.1; ZC101.2c.1; WBGene00006787 [Q06561-4]
ZC101.2e.1; ZC101.2e.1; WBGene00006787 [Q06561-1]
ZC101.2f.1; ZC101.2f.1; WBGene00006787

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
175126

UCSC genome browser

More...
UCSCi
ZC101.2e, c. elegans [Q06561-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L13458 Genomic DNA Translation: AAA28156.1
BX284602 Genomic DNA Translation: CAB07704.1
BX284602, Z93375 Genomic DNA Translation: CAB07706.1
BX284602, Z93375 Genomic DNA Translation: CAB07707.1
BX284602, Z93375 Genomic DNA Translation: CAB07708.1
BX284602, Z93375 Genomic DNA Translation: CAH04744.1
AF132883 mRNA Translation: AAD25092.1
PIRiC88369
F88369
T19821
RefSeqiNP_001022488.1, NM_001027317.5
NP_497044.3, NM_064643.8 [Q06561-1]
NP_497045.1, NM_064644.3 [Q06561-4]
NP_497046.1, NM_064645.4 [Q06561-2]
NP_497047.1, NM_064646.4 [Q06561-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi40407, 19 interactors
IntActiQ06561, 1 interactor
STRINGi6239.ZC101.2e

PTM databases

iPTMnetiQ06561

Proteomic databases

EPDiQ06561
PaxDbiQ06561
PeptideAtlasiQ06561
PRIDEiQ06561

Genome annotation databases

EnsemblMetazoaiZC101.2a.1; ZC101.2a.1; WBGene00006787 [Q06561-2]
ZC101.2b.1; ZC101.2b.1; WBGene00006787 [Q06561-3]
ZC101.2c.1; ZC101.2c.1; WBGene00006787 [Q06561-4]
ZC101.2e.1; ZC101.2e.1; WBGene00006787 [Q06561-1]
ZC101.2f.1; ZC101.2f.1; WBGene00006787
GeneIDi175126
UCSCiZC101.2e, c. elegans [Q06561-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
175126
WormBaseiZC101.2a ; CE15028 ; WBGene00006787 ; unc-52
ZC101.2b ; CE15030 ; WBGene00006787 ; unc-52
ZC101.2c ; CE15034 ; WBGene00006787 ; unc-52
ZC101.2e ; CE18424 ; WBGene00006787 ; unc-52
ZC101.2f ; CE37074 ; WBGene00006787 ; unc-52

Phylogenomic databases

eggNOGiKOG3509, Eukaryota
HOGENOMiCLU_000078_0_0_1
InParanoidiQ06561
OMAiRCQYIEH
OrthoDBi414294at2759
PhylomeDBiQ06561

Enzyme and pathway databases

ReactomeiR-CEL-1474228, Degradation of the extracellular matrix
R-CEL-1971475, A tetrasaccharide linker sequence is required for GAG synthesis
R-CEL-2022928, HS-GAG biosynthesis
R-CEL-2024096, HS-GAG degradation
R-CEL-3000157, Laminin interactions
R-CEL-3000171, Non-integrin membrane-ECM interactions
R-CEL-3000178, ECM proteoglycans

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q06561

Gene expression databases

BgeeiWBGene00006787, Expressed in material anatomical entity and 4 other tissues
ExpressionAtlasiQ06561, baseline and differential

Family and domain databases

CDDicd00112, LDLa, 2 hits
Gene3Di2.60.40.10, 17 hits
4.10.400.10, 3 hits
InterProiView protein in InterPro
IPR013320, ConA-like_dom_sf
IPR001881, EGF-like_Ca-bd_dom
IPR000742, EGF-like_dom
IPR009030, Growth_fac_rcpt_cys_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR002049, Laminin_EGF
IPR001791, Laminin_G
IPR000034, Laminin_IV
IPR036055, LDL_receptor-like_sf
IPR023415, LDLR_class-A_CS
IPR002172, LDrepeatLR_classA_rpt
PfamiView protein in Pfam
PF07679, I-set, 2 hits
PF13895, Ig_2, 2 hits
PF00052, Laminin_B, 2 hits
PF00053, Laminin_EGF, 7 hits
PF02210, Laminin_G_2, 3 hits
PF00057, Ldl_recept_a, 3 hits
PRINTSiPR00261, LDLRECEPTOR
SMARTiView protein in SMART
SM00181, EGF, 6 hits
SM00179, EGF_CA, 2 hits
SM00180, EGF_Lam, 6 hits
SM00409, IG, 17 hits
SM00408, IGc2, 17 hits
SM00281, LamB, 2 hits
SM00282, LamG, 3 hits
SM00192, LDLa, 3 hits
SUPFAMiSSF48726, SSF48726, 15 hits
SSF49899, SSF49899, 3 hits
SSF57184, SSF57184, 1 hit
SSF57424, SSF57424, 3 hits
PROSITEiView protein in PROSITE
PS00022, EGF_1, 7 hits
PS01186, EGF_2, 2 hits
PS50026, EGF_3, 3 hits
PS01248, EGF_LAM_1, 7 hits
PS50027, EGF_LAM_2, 5 hits
PS50835, IG_LIKE, 17 hits
PS50025, LAM_G_DOMAIN, 3 hits
PS51115, LAMININ_IVA, 2 hits
PS01209, LDLRA_1, 3 hits
PS50068, LDLRA_2, 3 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUNC52_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q06561
Secondary accession number(s): O18261
, O18263, Q6BEQ6, Q9U7E8, Q9XTD2, Q9XTI5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: April 23, 2003
Last modified: June 2, 2021
This is version 189 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again