Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q06547 (GABP1_HUMAN)

Entry version 203 (12 Aug 2020)
Sequence version 2 (19 Sep 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

GA-binding protein subunit beta-1

Gene

GABPB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor capable of interacting with purine rich repeats (GA repeats) (PubMed:8441384, PubMed:10675337, PubMed:8816484). Acts as a a master regulator of nuclear-encoded mitochondrial genes (By similarity).By similarity3 Publications
(Microbial infection) Necessary for the expression of the Adenovirus E4 gene.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q06547

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2151201, Transcriptional activation of mitochondrial biogenesis

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q06547

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GA-binding protein subunit beta-1
Short name:
GABP subunit beta-1
Short name:
GABPB-1
Alternative name(s):
GABP subunit beta-2
Short name:
GABPB-2
Nuclear respiratory factor 2
Transcription factor E4TF1-471 Publication
Transcription factor E4TF1-531 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GABPB1
Synonyms:E4TF1B1 Publication, GABPB, GABPB2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000104064.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:4074, GABPB1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600610, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q06547

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi262 – 263QQ → AA: Minor reduction in transcriptional activation; when associated with A-295 or A-305 and A-306. 1 Publication2
Mutagenesisi264 – 265VV → AA: Minor effect upon interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-297; A-298 and A-299, or with A-307 and A-310. 2 Publications2
Mutagenesisi270 – 271QQ → AA: Minor reduction in transcriptional activation. Moderate reduction in activity; when associated with A-305 and A-306. 1 Publication2
Mutagenesisi273 – 275ITI → ATA: Strongly reduces interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-297; A-298 and A-299, or with A-307 and A-310. 2 Publications3
Mutagenesisi295Q → A: No effect on transcriptional activation. Minor reduction in activity; when associated with A-270 and A-271. 1 Publication1
Mutagenesisi297 – 299IIV → AAA: Strongly reduces interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-264 and A-265, or A-273 and A-275. 2 Publications3
Mutagenesisi305 – 306QQ → AA: Minor reduction in transcriptional activation. Moderate reduction in activity; when associated with A-270 and A-271. 1 Publication2
Mutagenesisi307 – 310VLTV → ALTA: Moderately reduces interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-273 and A-275. 2 Publications4

Organism-specific databases

DisGeNET

More...DisGeNETi		2553

Open Targets

More...OpenTargetsi		ENSG00000104064

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162389163

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q06547, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GABPB1

Domain mapping of disease mutations (DMDM)

More...DMDMi		23503070

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000669932 – 395GA-binding protein subunit beta-1Add BLAST394

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei69N6-acetyllysineBy similarity1
Modified residuei352N6-acetyllysineBy similarity1
Modified residuei381N6-acetyllysineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated by EP300/p300. Deacetylated by SIRT7, promoting heterotetramerization and activity.By similarity

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q06547

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q06547

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q06547

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q06547

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q06547

PeptideAtlas

More...PeptideAtlasi		Q06547

PRoteomics IDEntifications database

More...PRIDEi		Q06547

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		58458 [Q06547-1]
58459 [Q06547-2]
58460 [Q06547-3]
58461 [Q06547-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q06547, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q06547

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q06547

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000104064, Expressed in intestine and 227 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q06547, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q06547, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000104064, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer of two alpha and two beta subunits (PubMed:7799916).

Interacts with HCFC1, causing repression of transcriptional activity (PubMed:10675337).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q06547

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati5 – 34ANK 1Add BLAST30
Repeati37 – 66ANK 2Add BLAST30
Repeati70 – 99ANK 3Add BLAST30
Repeati103 – 132ANK 4Add BLAST30
Repeati136 – 166ANK 5Add BLAST31

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni258 – 327Transcription activation and HCFC1 interactionAdd BLAST70

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QRTX, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157875

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000134_12_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q06547

KEGG Orthology (KO)

More...KOi		K09454

Identification of Orthologs from Complete Genome Data

More...OMAi		HWATEKG

Database of Orthologous Groups

More...OrthoDBi		1514706at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q06547

TreeFam database of animal gene trees

More...TreeFami		TF326036

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12796, Ank_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01415, ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00248, ANK, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48403, SSF48403, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q06547-1) [UniParc]FASTAAdd to basket
Also known as: GABPB-1, Beta-11 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLVDLGKKL LEAARAGQDD EVRILMANGA PFTTDWLGTS PLHLAAQYGH 
        60         70         80         90        100
YSTTEVLLRA GVSRDARTKV DRTPLHMAAS EGHASIVEVL LKHGADVNAK 
       110        120        130        140        150
DMLKMTALHW ATEHNHQEVV ELLIKYGADV HTQSKFCKTA FDISIDNGNE 
       160        170        180        190        200
DLAEILQIAM QNQINTNPES PDTVTIHAAT PQFIIGPGGV VNLTGLVSSE 
       210        220        230        240        250
NSSKATDETG VSAVQFGNSS TSVLATLAAL AEASAPLSNS SETPVVATEE 
       260        270        280        290        300
VVTAESVDGA IQQVVSSGGQ QVITIVTDGI QLGNLHSIPT SGIGQPIIVT 
       310        320        330        340        350
MPDGQQVLTV PATDIAEETV ISEEPPAKRQ CIEIIENRVE SAEIEEREAL 
       360        370        380        390 
QKQLDEANRE AQKYRQQLLK KEQEAEAYRQ KLEAMTRLQT NKEAV
Length:395
Mass (Da):42,483
Last modified:September 19, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i723D63962FB29BD9
GO
Isoform 2 (identifier: Q06547-2) [UniParc]FASTAAdd to basket
Also known as: Beta-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     195-206: Missing.

Show »
Length:383
Mass (Da):41,321
Checksum:i07E7081A60016288
GO
Isoform 3 (identifier: Q06547-3) [UniParc]FASTAAdd to basket
Also known as: GABPB-2, Gamma-11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     346-395: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV → VRSLLPGVLCRSHPK

Show »
Length:360
Mass (Da):38,111
Checksum:i39917E58EF91120F
GO
Isoform 4 (identifier: Q06547-4) [UniParc]FASTAAdd to basket
Also known as: Gamma-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     195-206: Missing.
     346-395: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV → VRSLLPGVLCRSHPK

Show »
Length:348
Mass (Da):36,950
Checksum:i9657186214E046D5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H7I4F5H7I4_HUMAN
GA-binding protein subunit beta-1
GABPB1
319Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9ZYI9H9ZYI9_HUMAN
GA binding protein transcription fa...
GABPB1 GABPB2, hCG_2002404
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YNZ0H0YNZ0_HUMAN
GA-binding protein subunit beta-1
GABPB1
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YMZ5H0YMZ5_HUMAN
GA-binding protein subunit beta-1
GABPB1
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti76H → L AA sequence (PubMed:7918435).Curated1
Sequence conflicti246Missing in BAA02573 (PubMed:8441384).Curated1
Sequence conflicti274T → A in AAH36080 (PubMed:15489334).Curated1
Sequence conflicti341S → C AA sequence (PubMed:8383622).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03561331P → A in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000275195 – 206Missing in isoform 2 and isoform 4. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_009337346 – 395EREAL…NKEAV → VRSLLPGVLCRSHPK in isoform 3 and isoform 4. 3 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D13316 mRNA Translation: BAA02573.1
D13317 mRNA Translation: BAA02574.1
U13045 mRNA Translation: AAA65707.1
U13046 mRNA Translation: AAA65708.1
U13047 mRNA Translation: AAA65709.1
U13048 mRNA Translation: AAA65710.1
EU159454 mRNA Translation: ABV90874.1
BT006652 mRNA Translation: AAP35298.1
CH471082 Genomic DNA Translation: EAW77395.1
BC016910 mRNA Translation: AAH16910.1
BC036080 mRNA Translation: AAH36080.1
BC050702 mRNA Translation: AAH50702.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10135.1 [Q06547-2]
CCDS10136.1 [Q06547-4]
CCDS32239.1 [Q06547-1]
CCDS45258.1 [Q06547-3]

Protein sequence database of the Protein Information Resource

More...PIRi		C48146
I38741
I38743
I38744

NCBI Reference Sequences

More...RefSeqi		NP_001307839.1, NM_001320910.1 [Q06547-1]
NP_002032.2, NM_002041.4 [Q06547-3]
NP_005245.2, NM_005254.5 [Q06547-1]
NP_057738.1, NM_016654.4 [Q06547-2]
NP_057739.1, NM_016655.4 [Q06547-4]
NP_852092.1, NM_181427.3 [Q06547-4]
XP_005254331.1, XM_005254274.3 [Q06547-1]
XP_016877542.1, XM_017022053.1 [Q06547-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000220429; ENSP00000220429; ENSG00000104064 [Q06547-1]
ENST00000359031; ENSP00000351923; ENSG00000104064 [Q06547-4]
ENST00000380877; ENSP00000370259; ENSG00000104064 [Q06547-2]
ENST00000396464; ENSP00000379728; ENSG00000104064 [Q06547-4]
ENST00000429662; ENSP00000395771; ENSG00000104064 [Q06547-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2553

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2553

UCSC genome browser

More...UCSCi		uc001zya.4, human [Q06547-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13316 mRNA Translation: BAA02573.1
D13317 mRNA Translation: BAA02574.1
U13045 mRNA Translation: AAA65707.1
U13046 mRNA Translation: AAA65708.1
U13047 mRNA Translation: AAA65709.1
U13048 mRNA Translation: AAA65710.1
EU159454 mRNA Translation: ABV90874.1
BT006652 mRNA Translation: AAP35298.1
CH471082 Genomic DNA Translation: EAW77395.1
BC016910 mRNA Translation: AAH16910.1
BC036080 mRNA Translation: AAH36080.1
BC050702 mRNA Translation: AAH50702.1
CCDSiCCDS10135.1 [Q06547-2]
CCDS10136.1 [Q06547-4]
CCDS32239.1 [Q06547-1]
CCDS45258.1 [Q06547-3]
PIRiC48146
I38741
I38743
I38744
RefSeqiNP_001307839.1, NM_001320910.1 [Q06547-1]
NP_002032.2, NM_002041.4 [Q06547-3]
NP_005245.2, NM_005254.5 [Q06547-1]
NP_057738.1, NM_016654.4 [Q06547-2]
NP_057739.1, NM_016655.4 [Q06547-4]
NP_852092.1, NM_181427.3 [Q06547-4]
XP_005254331.1, XM_005254274.3 [Q06547-1]
XP_016877542.1, XM_017022053.1 [Q06547-2]

3D structure databases

SMRiQ06547
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi108827, 31 interactors
DIPiDIP-33979N
IntActiQ06547, 32 interactors
MINTiQ06547
STRINGi9606.ENSP00000220429

PTM databases

GlyGeniQ06547, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ06547
PhosphoSitePlusiQ06547

Polymorphism and mutation databases

BioMutaiGABPB1
DMDMi23503070

Proteomic databases

EPDiQ06547
jPOSTiQ06547
MassIVEiQ06547
MaxQBiQ06547
PaxDbiQ06547
PeptideAtlasiQ06547
PRIDEiQ06547
ProteomicsDBi58458 [Q06547-1]
58459 [Q06547-2]
58460 [Q06547-3]
58461 [Q06547-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1425, 319 antibodies

The DNASU plasmid repository

More...DNASUi		2553

Genome annotation databases

EnsembliENST00000220429; ENSP00000220429; ENSG00000104064 [Q06547-1]
ENST00000359031; ENSP00000351923; ENSG00000104064 [Q06547-4]
ENST00000380877; ENSP00000370259; ENSG00000104064 [Q06547-2]
ENST00000396464; ENSP00000379728; ENSG00000104064 [Q06547-4]
ENST00000429662; ENSP00000395771; ENSG00000104064 [Q06547-3]
GeneIDi2553
KEGGihsa:2553
UCSCiuc001zya.4, human [Q06547-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2553
DisGeNETi2553
EuPathDBiHostDB:ENSG00000104064.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		GABPB1
HGNCiHGNC:4074, GABPB1
HPAiENSG00000104064, Low tissue specificity
MIMi600610, gene
neXtProtiNX_Q06547
OpenTargetsiENSG00000104064
PharmGKBiPA162389163

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QRTX, Eukaryota
GeneTreeiENSGT00940000157875
HOGENOMiCLU_000134_12_0_1
InParanoidiQ06547
KOiK09454
OMAiHWATEKG
OrthoDBi1514706at2759
PhylomeDBiQ06547
TreeFamiTF326036

Enzyme and pathway databases

PathwayCommonsiQ06547
ReactomeiR-HSA-2151201, Transcriptional activation of mitochondrial biogenesis
SIGNORiQ06547

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2553, 312 hits in 887 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GABPB1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		GABPB2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2553
PharosiQ06547, Tbio

Protein Ontology

More...PROi		PR:Q06547
RNActiQ06547, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000104064, Expressed in intestine and 227 other tissues
ExpressionAtlasiQ06547, baseline and differential
GenevisibleiQ06547, HS

Family and domain databases

Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796, Ank_2, 1 hit
PRINTSiPR01415, ANKYRIN
SMARTiView protein in SMART
SM00248, ANK, 4 hits
SUPFAMiSSF48403, SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGABP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q06547
Secondary accession number(s): A8IE52
, Q06545, Q12940, Q12941, Q12942, Q8IYD0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: September 19, 2002
Last modified: August 12, 2020
This is version 203 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again