Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q06455 (MTG8_HUMAN)

Entry version 207 (12 Aug 2020)
Sequence version 2 (01 Nov 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein CBFA2T1

Gene

RUNX1T1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional corepressor which facilitates transcriptional repression via its association with DNA-binding transcription factors and recruitment of other corepressors and histone-modifying enzymes (PubMed:12559562, PubMed:15203199). Can repress the expression of MMP7 in a ZBTB33-dependent manner (PubMed:23251453). Can repress transactivation mediated by TCF12 (PubMed:16803958). Acts as a negative regulator of adipogenesis (By similarity). The AML1-MTG8/ETO fusion protein frequently found in leukemic cells is involved in leukemogenesis and contributes to hematopoietic stem/progenitor cell self-renewal (PubMed:23812588).2 PublicationsBy similarity4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri515 – 551MYND-typePROSITE-ProRule annotationAdd BLAST37

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q06455

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q06455

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein CBFA2T1
Alternative name(s):
Cyclin-D-related protein
Eight twenty one protein
Protein ETO
Protein MTG8
Zinc finger MYND domain-containing protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RUNX1T1
Synonyms:AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000079102.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:1535, RUNX1T1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		133435, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q06455

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving RUNX1T1 is a cause of acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1/AML1.4 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi125K → A or D: Loss of interaction with TCF12. 1 Publication1
Mutagenesisi126L → A: Loss of interaction with TCF12. 1 Publication1
Mutagenesisi128R → D: Loss of interaction with TCF12. 1 Publication1
Mutagenesisi129F → A: Loss of interaction with TCF12. 2 Publications1
Mutagenesisi129F → K: Abolishes interaction with corepressor. 2 Publications1
Mutagenesisi136F → A: Abolishes interaction with corepressor. 1 Publication1
Mutagenesisi170Q → A: Abolishes interaction with corepressor. 1 Publication1
Mutagenesisi173T → Q: Abolishes interaction with corepressor. 1 Publication1
Mutagenesisi175F → A: Abolishes interaction with corepressor. 1 Publication1
Mutagenesisi177L → A: Abolishes interaction with corepressor. 1 Publication1
Mutagenesisi178R → A or D: Loss of interaction with TCF12. 1 Publication1
Mutagenesisi184F → A: Loss of interaction with TCF12. 1 Publication1
Mutagenesisi345L → E: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2; when associated with R-357; R-360; E-361; E-375; R-378 and R-389. 2 Publications1
Mutagenesisi352 – 353EE → AA: Decreases interaction with TCF12, no effect on oligomerization. Impairs AML1-MTG8/ETO activity in hematopoietic stem/progenitor cell self-renewal but no effect in inhibiting differentiation; when associated with 379-A--A-381. 1 Publication2
Mutagenesisi357L → R: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2; when associated with E-345; R-360; E- 61; E-375; R-378 and R-389. 2 Publications1
Mutagenesisi360L → R: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2; when associated with E-345; R-357; E-361; E-375; R-378 and R-389. 2 Publications1
Mutagenesisi361L → E: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2; when associated with E-345; R-357; R-360; E-375; R-378 and R-389. 2 Publications1
Mutagenesisi375L → E: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2; when associated with E-345; R-357; R-360; E-361; R-378 and R-389. 2 Publications1
Mutagenesisi378L → R: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2 when associated with E-345; R-357; R-360; E-361; E-375 and R-389. 2 Publications1
Mutagenesisi379 – 381RRC → AAA: Disrupts interaction with TCF12, no effect on oligomerization. Impairs AML1-MTG8/ETO activity in hematopoietic stem/progenitor cell self-renewal but no effect in inhibiting differentiation; when associated with 352-E-E-353. 1 Publication3
Mutagenesisi389L → R: Disrupts tetramerization, disrupts AML1-MTG8/ETO interaction with TCF12, decreases AML1-MTG8/ETO interaction with RUNX1T1, CBFA2T3 and CBFA2T2; when associated with E-345; R-357; R-360; E-361; E-375 and R-378. 2 Publications1
Mutagenesisi547H → A: Causes unfolding of the MYND-type zinc finger domain. 1 Publication1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei30 – 31Breakpoint for translocation to form AML1-MTG8 in AML-M21 Publication2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...DisGeNETi		862

MalaCards human disease database

More...MalaCardsi		RUNX1T1

Open Targets

More...OpenTargetsi		ENSG00000079102

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		102724, Acute myeloid leukemia with t(8;21)(q22;q22) translocation

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26111

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q06455, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RUNX1T1

Domain mapping of disease mutations (DMDM)

More...DMDMi		2498595

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002182991 – 604Protein CBFA2T1Add BLAST604

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei41PhosphoserineCombined sources1
Modified residuei417PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q06455

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q06455

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q06455

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q06455

PeptideAtlas

More...PeptideAtlasi		Q06455

PRoteomics IDEntifications database

More...PRIDEi		Q06455

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		17401
58447 [Q06455-1]
58448 [Q06455-2]
69196

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q06455

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q06455

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000079102, Expressed in forebrain and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q06455, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q06455, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000079102, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer. Homotetramerization is mediated by nervy homology region 2 (NRH2). Can interact with CBFA2T2 and CBFA2T3; heterotetramerization between members of the CBFA2T family is proposed.

Interacts with TCF12, SIN3A, HDAC1, HDAC2, HDAC3, NCOR1, NCOR2.

Interacts with ATN1 (via its N-terminus); the interaction enhances the transcriptional repression. AML1-MTG8/ETO fusion protein interacts with CBFB. AML1-MTG8/ETO is part of a stable transcription factor complex AETFC in leukemic cells; AETFC formation seems to be involved in recruitment of EP300. AML1-MTG8/ETO nervy homology region 2-mediated oligomerization is proposed to be homotypic, required for AML1-MTG8/ETO-mediated transformation of primary hematopoietic cells and is required for AML1-MTG8/ETO interaction with TCF12.

8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q06455
With#Exp.IntAct
NCOR1 [O75376]5EBI-743342,EBI-347233
SP1 [P08047]2EBI-743342,EBI-298336
Son [Q9QX47] from Mus musculus.4EBI-743342,EBI-643037
Isoform MTG8A [Q06455-2]
With#Exp.IntAct
ABI3 [Q9P2A4]3EBI-11984663,EBI-742038
ADAMTSL4 - isoform 3 [Q6UY14-3]3EBI-11984663,EBI-10173507
ARHGAP9 [Q9BRR9]3EBI-11984663,EBI-750254
ATN1 [Q86V38]3EBI-11984663,EBI-11954292
BIRC2 [Q13490]3EBI-11984663,EBI-514538
CBY2 - isoform 2 [Q8NA61-2]3EBI-11984663,EBI-11524851
CCDC197 [Q8NCU1]3EBI-11984663,EBI-750686
CCDC36 [Q8IYA8]3EBI-11984663,EBI-8638439
CDC23 [Q9UJX2]3EBI-11984663,EBI-396137
CDR2 [Q01850]3EBI-11984663,EBI-1181367
CEP83 - isoform 2 [Q9Y592-2]3EBI-11984663,EBI-11123098
COG6 [Q9Y2V7]3EBI-11984663,EBI-3866319
CPSF7 - isoform 3 [Q8N684-3]3EBI-11984663,EBI-11523759
DEUP1 [Q05D60]3EBI-11984663,EBI-748597
FAM136A [Q96C01]3EBI-11984663,EBI-373319
FAM9A [Q8IZU1]3EBI-11984663,EBI-8468186
HOMER3 [Q9NSC5]3EBI-11984663,EBI-748420
HOXB2 [P14652]3EBI-11984663,EBI-5329558
KIAA0408 [Q6ZU52]5EBI-11984663,EBI-739493
KIFC3 - isoform 4 [Q9BVG8-5]3EBI-11984663,EBI-14069005
KRT23 [Q9C075]3EBI-11984663,EBI-3211278
KRT27 [Q7Z3Y8]3EBI-11984663,EBI-3044087
KRT33B [Q14525]3EBI-11984663,EBI-1049638
KRT35 [Q92764]3EBI-11984663,EBI-1058674
KRTAP13-3 [Q3SY46]3EBI-11984663,EBI-10241252
KRTAP19-6 [Q3LI70]3EBI-11984663,EBI-12805508
KRTAP6-2 [Q3LI66]3EBI-11984663,EBI-11962084
LHX3 - isoform B [Q9UBR4-2]3EBI-11984663,EBI-12039345
LPXN [O60711]3EBI-11984663,EBI-744222
LZTS1 [Q9Y250]3EBI-11984663,EBI-1216080
MEOX2 [Q6FHY5]3EBI-11984663,EBI-16439278
MID2 - isoform 2 [Q9UJV3-2]3EBI-11984663,EBI-10172526
NECAB2 - isoform 2 [Q7Z6G3-2]3EBI-11984663,EBI-10172876
OIP5 [O43482]3EBI-11984663,EBI-536879
PIAS2 - isoform PIAS2-alpha [O75928-2]5EBI-11984663,EBI-348567
PLSCR3 [Q9NRY6]3EBI-11984663,EBI-750734
PRDM14 [Q9GZV8]6EBI-11984663,EBI-3957793
PRDM6 [Q9NQX0]3EBI-11984663,EBI-11320284
PRKAR1B [P31321]3EBI-11984663,EBI-2805516
RAD54L2 [Q9Y4B4]3EBI-11984663,EBI-948156
REL - isoform 2 [Q04864-2]3EBI-11984663,EBI-10829018
RNF4 [P78317]3EBI-11984663,EBI-2340927
RTN4IP1 [Q8WWV3]3EBI-11984663,EBI-743502
SORBS3 [O60504]3EBI-11984663,EBI-741237
SYCE1 [Q8N0S2]3EBI-11984663,EBI-6872807
TEKT1 [Q969V4]3EBI-11984663,EBI-10180409
TFIP11 [Q9UBB9]3EBI-11984663,EBI-1105213
TRIM54 [Q9BYV2]3EBI-11984663,EBI-2130429
VPS52 [Q8N1B4]3EBI-11984663,EBI-2799833
WBP11 [Q9Y2W2]3EBI-11984663,EBI-714455
XIAP [P98170]3EBI-11984663,EBI-517127
ZFP36 [P26651]3EBI-11984663,EBI-374248
ZFP90 [Q8TF47]3EBI-11984663,EBI-11419867
ZNF343 [Q6P1L6]3EBI-11984663,EBI-10252492
ZNF655 [Q8N720]3EBI-11984663,EBI-625509
Q7Z7833EBI-11984663,EBI-9088990
Isoform 4 [Q06455-4]
With#Exp.IntAct
ABI3 [Q9P2A4]3EBI-10224192,EBI-742038
C19orf57 [Q0VDD7]3EBI-10224192,EBI-741210
CBY2 [Q8NA61]3EBI-10224192,EBI-741724
CCDC36 [Q8IYA8]3EBI-10224192,EBI-8638439
CPSF7 [Q8N684]3EBI-10224192,EBI-746909
CREB3L1 [Q96BA8]3EBI-10224192,EBI-6942903
EFHC2 [Q5JST6]3EBI-10224192,EBI-2349927
EPS8 [Q12929]3EBI-10224192,EBI-375576
GSE1 [Q14687]3EBI-10224192,EBI-372619
HOMER3 [Q9NSC5]3EBI-10224192,EBI-748420
LPXN [O60711]3EBI-10224192,EBI-744222
LZTS2 [Q9BRK4]3EBI-10224192,EBI-741037
MEOX2 [P50222]3EBI-10224192,EBI-748397
MID2 - isoform 2 [Q9UJV3-2]3EBI-10224192,EBI-10172526
NECAB2 - isoform 2 [Q7Z6G3-2]3EBI-10224192,EBI-10172876
PRDM14 [Q9GZV8]3EBI-10224192,EBI-3957793
SPRY2 [O43597]3EBI-10224192,EBI-742487
STX11 [O75558]3EBI-10224192,EBI-714135
TCF12 - isoform 3 [Q99081-3]2EBI-10224192,EBI-11952764
TRIM42 [Q8IWZ5]3EBI-10224192,EBI-5235829
ZMYM4 [Q5VZL5]3EBI-10224192,EBI-2514659

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107310, 61 interactors

Database of interacting proteins

More...DIPi		DIP-29401N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q06455

Protein interaction database and analysis system

More...IntActi		Q06455, 85 interactors

Molecular INTeraction database

More...MINTi		Q06455

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000402257

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q06455, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1604
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q06455

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q06455

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini120 – 215TAFHPROSITE-ProRule annotationAdd BLAST96

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni337 – 383Important for oligomerizationAdd BLAST47
Regioni337 – 383Nervy homology region 2 (NHR2)1 PublicationAdd BLAST47
Regioni443 – 492Nervy homology region 3 (NHR3)1 PublicationAdd BLAST50

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi57 – 60Poly-Pro4
Compositional biasi102 – 108Poly-Ser7
Compositional biasi290 – 297Poly-Pro8
Compositional biasi408 – 413Poly-Ser6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The TAFH domain mediates interaction with transcription regulators.1 Publication
Nervy homology region 2 (NHR2) mediates homo- and possibly heterotypic oligomerization by forming a four-helix bundle tetrameric structure.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CBFA2T family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri515 – 551MYND-typePROSITE-ProRule annotationAdd BLAST37

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QTD6, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183176

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_022077_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q06455

KEGG Orthology (KO)

More...KOi		K10053

Database of Orthologous Groups

More...OrthoDBi		334242at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q06455

TreeFam database of animal gene trees

More...TreeFami		TF106303

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.120.1110, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00381

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013290, CBFA2T1
IPR013289, CBFA2T1/2/3
IPR014896, NHR2
IPR037249, TAFH/NHR1_dom_sf
IPR003894, TAFH_NHR1
IPR002893, Znf_MYND

The PANTHER Classification System

More...PANTHERi		PTHR10379, PTHR10379, 1 hit
PTHR10379:SF5, PTHR10379:SF5, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08788, NHR2, 1 hit
PF07531, TAFH, 1 hit
PF01753, zf-MYND, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01875, ETOFAMILY
PR01876, MTG8PROTEIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00549, TAFH, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF158553, SSF158553, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51119, TAFH, 1 hit
PS01360, ZF_MYND_1, 1 hit
PS50865, ZF_MYND_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 28 potential isoforms that are computationally mapped.Show allAlign All

Isoform MTG8B (identifier: Q06455-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MISVKRNTWR ALSLVIGDCR KKGNFEYCQD RTEKHSTMPD SPVDVKTQSR 
        60         70         80         90        100
LTPPTMPPPP TTQGAPRTSS FTPTTLTNGT SHSPTALNGA PSPPNGFSNG 
       110        120        130        140        150
PSSSSSSSLA NQQLPPACGA RQLSKLKRFL TTLQQFGNDI SPEIGERVRT 
       160        170        180        190        200
LVLGLVNSTL TIEEFHSKLQ EATNFPLRPF VIPFLKANLP LLQRELLHCA 
       210        220        230        240        250
RLAKQNPAQY LAQHEQLLLD ASTTSPVDSS ELLLDVNENG KRRTPDRTKE 
       260        270        280        290        300
NGFDREPLHS EHPSKRPCTI SPGQRYSPNN GLSYQPNGLP HPTPPPPQHY 
       310        320        330        340        350
RLDDMAIAHH YRDSYRHPSH RDLRDRNRPM GLHGTRQEEM IDHRLTDREW 
       360        370        380        390        400
AEEWKHLDHL LNCIMDMVEK TRRSLTVLRR CQEADREELN YWIRRYSDAE 
       410        420        430        440        450
DLKKGGGSSS SHSRQQSPVN PDPVALDAHR EFLHRPASGY VPEEIWKKAE 
       460        470        480        490        500
EAVNEVKRQA MTELQKAVSE AERKAHDMIT TERAKMERTV AEAKRQAAED 
       510        520        530        540        550
ALAVINQQED SSESCWNCGR KASETCSGCN TARYCGSFCQ HKDWEKHHHI 
       560        570        580        590        600
CGQTLQAQQQ GDTPAVSSSV TPNSGAGSPM DTPPAATPRS TTPGTPSTIE 

TTPR
Length:604
Mass (Da):67,566
Last modified:November 1, 1997 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC3D2452F96E65679
GO
Isoform MTG8A (identifier: Q06455-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MISVKRNTWRALSLVIGDCRKKGNFEYCQ → MP

Show »
Length:577
Mass (Da):64,396
Checksum:i70E84F0120C11C3B
GO
Isoform 3 (identifier: Q06455-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MISVKRNTWRALSLVIGDCRKKGNFEYCQ → MCHPDKAFTSDKLQCVFNEYKAAVWVPPRPRPLSRAPLPE

Show »
Length:615
Mass (Da):68,746
Checksum:i4FB11B0FAEC56B07
GO
Isoform 4 (identifier: Q06455-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: Missing.

Show »
Length:567
Mass (Da):63,212
Checksum:i44AADF2EC7032050
GO
Isoform MTG8B-2 (identifier: Q06455-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-427: D → G
     428-604: Missing.

Show »
Length:427
Mass (Da):48,146
Checksum:iA4482697E23DD852
GO
Isoform MTG8A-2 (identifier: Q06455-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MISVKRNTWRALSLVIGDCRKKGNFEYCQ → MP
     427-427: D → G
     428-604: Missing.

Show »
Length:400
Mass (Da):44,975
Checksum:i451BFA533E281CDE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 28 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSU1A0A0A0MSU1_HUMAN
Protein CBFA2T1
RUNX1T1
663Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWT6A0A087WWT6_HUMAN
Protein CBFA2T1
RUNX1T1 hCG_20715
584Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RG85E5RG85_HUMAN
Protein CBFA2T1
RUNX1T1
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHJ8E5RHJ8_HUMAN
Protein CBFA2T1
RUNX1T1
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ETA8E7ETA8_HUMAN
Protein CBFA2T1
RUNX1T1
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EWJ9E7EWJ9_HUMAN
Protein CBFA2T1
RUNX1T1
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RH30E5RH30_HUMAN
Protein CBFA2T1
RUNX1T1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQW3E7EQW3_HUMAN
Protein CBFA2T1
RUNX1T1
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RH72E5RH72_HUMAN
Protein CBFA2T1
RUNX1T1
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJ32E5RJ32_HUMAN
Protein CBFA2T1
RUNX1T1
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH05850 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAA03247 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti455E → G in BAH12630 (PubMed:14702039).Curated1
Sequence conflicti506N → S in BAH12630 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036321386R → W in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1301792645Ensembl.1
Natural variantiVAR_036322395R → W in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1448417558Ensembl.1
Natural variantiVAR_036323471A → V in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1462140811Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0454421 – 37Missing in isoform 4. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_0445581 – 29MISVK…FEYCQ → MCHPDKAFTSDKLQCVFNEY KAAVWVPPRPRPLSRAPLPE in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0033271 – 29MISVK…FEYCQ → MP in isoform MTG8A and isoform MTG8A-2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_058512427D → G in isoform MTG8B-2 and isoform MTG8A-2. 1 Publication1
Alternative sequenceiVSP_058513428 – 604Missing in isoform MTG8B-2 and isoform MTG8A-2. 1 PublicationAdd BLAST177

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D14821 mRNA Translation: BAA03558.1
D13979 mRNA Translation: BAA03089.1 Sequence problems.
D14289 mRNA Translation: BAA03247.1 Different initiation.
AF018282 AF018281 Genomic DNA Translation: AAC28932.1
AF018282 AF018281 Genomic DNA Translation: AAC28931.1
AF018283 mRNA Translation: AAC26143.1
AK297616 mRNA Translation: BAH12630.1
BT009871 mRNA Translation: AAP88873.1
CR456792 mRNA Translation: CAG33073.1
AC103680 Genomic DNA No translation available.
AC104339 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW91685.1
BC005850 mRNA Translation: AAH05850.1 Different initiation.
BC067078 mRNA Translation: AAH67078.2
AF181450 Genomic DNA No translation available.
D43638 mRNA Translation: BAA07755.1
X79990 mRNA Translation: CAA56311.1
S74096 Genomic DNA Translation: AAB32126.1
S74092 Genomic DNA No translation available.
S78158 mRNA Translation: AAB34819.2 Sequence problems.
S78159 mRNA Translation: AAB34820.2 Sequence problems.
D14822 mRNA Translation: BAA03559.1 Sequence problems.
D14823 mRNA Translation: BAA03560.1 Sequence problems.
S50186 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47891.1 [Q06455-2]
CCDS56544.1 [Q06455-3]
CCDS6256.1 [Q06455-1]
CCDS6257.1 [Q06455-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A57784
C57784

NCBI Reference Sequences

More...RefSeqi		NP_001185554.1, NM_001198625.1 [Q06455-2]
NP_001185555.1, NM_001198626.1 [Q06455-1]
NP_001185556.1, NM_001198627.1 [Q06455-1]
NP_001185557.1, NM_001198628.1 [Q06455-1]
NP_001185558.1, NM_001198629.1 [Q06455-1]
NP_001185559.1, NM_001198630.1 [Q06455-1]
NP_001185560.1, NM_001198631.1 [Q06455-1]
NP_001185561.1, NM_001198632.1 [Q06455-2]
NP_001185562.1, NM_001198633.1
NP_001185563.1, NM_001198634.1 [Q06455-3]
NP_001185608.1, NM_001198679.1
NP_004340.1, NM_004349.3 [Q06455-2]
NP_783552.1, NM_175634.2 [Q06455-1]
NP_783553.1, NM_175635.2 [Q06455-4]
NP_783554.1, NM_175636.2 [Q06455-4]
XP_006716739.1, XM_006716676.3 [Q06455-4]
XP_011515653.1, XM_011517351.2 [Q06455-1]
XP_011515654.1, XM_011517352.2 [Q06455-2]
XP_011515655.1, XM_011517353.2 [Q06455-4]
XP_016869420.1, XM_017013931.1
XP_016869421.1, XM_017013932.1 [Q06455-2]
XP_016869422.1, XM_017013933.1 [Q06455-2]
XP_016869423.1, XM_017013934.1 [Q06455-4]
XP_016869424.1, XM_017013935.1 [Q06455-4]
XP_016869425.1, XM_017013936.1 [Q06455-4]
XP_016869426.1, XM_017013937.1 [Q06455-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000265814; ENSP00000265814; ENSG00000079102 [Q06455-1]
ENST00000360348; ENSP00000353504; ENSG00000079102 [Q06455-4]
ENST00000396218; ENSP00000379520; ENSG00000079102 [Q06455-2]
ENST00000422361; ENSP00000390137; ENSG00000079102 [Q06455-4]
ENST00000518844; ENSP00000430728; ENSG00000079102 [Q06455-2]
ENST00000520724; ENSP00000428742; ENSG00000079102 [Q06455-3]
ENST00000523629; ENSP00000428543; ENSG00000079102 [Q06455-1]
ENST00000613302; ENSP00000481799; ENSG00000079102 [Q06455-1]
ENST00000613886; ENSP00000478331; ENSG00000079102 [Q06455-2]
ENST00000614812; ENSP00000481315; ENSG00000079102 [Q06455-1]
ENST00000617740; ENSP00000481112; ENSG00000079102 [Q06455-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		862

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:862

UCSC genome browser

More...UCSCi		uc003yfc.3, human [Q06455-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14821 mRNA Translation: BAA03558.1
D13979 mRNA Translation: BAA03089.1 Sequence problems.
D14289 mRNA Translation: BAA03247.1 Different initiation.
AF018282 AF018281 Genomic DNA Translation: AAC28932.1
AF018282 AF018281 Genomic DNA Translation: AAC28931.1
AF018283 mRNA Translation: AAC26143.1
AK297616 mRNA Translation: BAH12630.1
BT009871 mRNA Translation: AAP88873.1
CR456792 mRNA Translation: CAG33073.1
AC103680 Genomic DNA No translation available.
AC104339 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW91685.1
BC005850 mRNA Translation: AAH05850.1 Different initiation.
BC067078 mRNA Translation: AAH67078.2
AF181450 Genomic DNA No translation available.
D43638 mRNA Translation: BAA07755.1
X79990 mRNA Translation: CAA56311.1
S74096 Genomic DNA Translation: AAB32126.1
S74092 Genomic DNA No translation available.
S78158 mRNA Translation: AAB34819.2 Sequence problems.
S78159 mRNA Translation: AAB34820.2 Sequence problems.
D14822 mRNA Translation: BAA03559.1 Sequence problems.
D14823 mRNA Translation: BAA03560.1 Sequence problems.
S50186 Genomic DNA No translation available.
CCDSiCCDS47891.1 [Q06455-2]
CCDS56544.1 [Q06455-3]
CCDS6256.1 [Q06455-1]
CCDS6257.1 [Q06455-4]
PIRiA57784
C57784
RefSeqiNP_001185554.1, NM_001198625.1 [Q06455-2]
NP_001185555.1, NM_001198626.1 [Q06455-1]
NP_001185556.1, NM_001198627.1 [Q06455-1]
NP_001185557.1, NM_001198628.1 [Q06455-1]
NP_001185558.1, NM_001198629.1 [Q06455-1]
NP_001185559.1, NM_001198630.1 [Q06455-1]
NP_001185560.1, NM_001198631.1 [Q06455-1]
NP_001185561.1, NM_001198632.1 [Q06455-2]
NP_001185562.1, NM_001198633.1
NP_001185563.1, NM_001198634.1 [Q06455-3]
NP_001185608.1, NM_001198679.1
NP_004340.1, NM_004349.3 [Q06455-2]
NP_783552.1, NM_175634.2 [Q06455-1]
NP_783553.1, NM_175635.2 [Q06455-4]
NP_783554.1, NM_175636.2 [Q06455-4]
XP_006716739.1, XM_006716676.3 [Q06455-4]
XP_011515653.1, XM_011517351.2 [Q06455-1]
XP_011515654.1, XM_011517352.2 [Q06455-2]
XP_011515655.1, XM_011517353.2 [Q06455-4]
XP_016869420.1, XM_017013931.1
XP_016869421.1, XM_017013932.1 [Q06455-2]
XP_016869422.1, XM_017013933.1 [Q06455-2]
XP_016869423.1, XM_017013934.1 [Q06455-4]
XP_016869424.1, XM_017013935.1 [Q06455-4]
XP_016869425.1, XM_017013936.1 [Q06455-4]
XP_016869426.1, XM_017013937.1 [Q06455-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WQ6X-ray2.00A/B335-403[»]
2DJ8NMR-A505-551[»]
2H7BNMR-A120-222[»]
2KNHNMR-A119-216[»]
2KYGNMR-C437-467[»]
2OD1NMR-A510-559[»]
2ODDNMR-A510-559[»]
2PP4NMR-A119-225[»]
4JOLX-ray2.91A/B/C/D338-400[»]
SMRiQ06455
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107310, 61 interactors
DIPiDIP-29401N
ELMiQ06455
IntActiQ06455, 85 interactors
MINTiQ06455
STRINGi9606.ENSP00000402257

PTM databases

iPTMnetiQ06455
PhosphoSitePlusiQ06455

Polymorphism and mutation databases

BioMutaiRUNX1T1
DMDMi2498595

Proteomic databases

jPOSTiQ06455
MassIVEiQ06455
MaxQBiQ06455
PaxDbiQ06455
PeptideAtlasiQ06455
PRIDEiQ06455
ProteomicsDBi17401
58447 [Q06455-1]
58448 [Q06455-2]
69196

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		25672, 274 antibodies

The DNASU plasmid repository

More...DNASUi		862

Genome annotation databases

EnsembliENST00000265814; ENSP00000265814; ENSG00000079102 [Q06455-1]
ENST00000360348; ENSP00000353504; ENSG00000079102 [Q06455-4]
ENST00000396218; ENSP00000379520; ENSG00000079102 [Q06455-2]
ENST00000422361; ENSP00000390137; ENSG00000079102 [Q06455-4]
ENST00000518844; ENSP00000430728; ENSG00000079102 [Q06455-2]
ENST00000520724; ENSP00000428742; ENSG00000079102 [Q06455-3]
ENST00000523629; ENSP00000428543; ENSG00000079102 [Q06455-1]
ENST00000613302; ENSP00000481799; ENSG00000079102 [Q06455-1]
ENST00000613886; ENSP00000478331; ENSG00000079102 [Q06455-2]
ENST00000614812; ENSP00000481315; ENSG00000079102 [Q06455-1]
ENST00000617740; ENSP00000481112; ENSG00000079102 [Q06455-1]
GeneIDi862
KEGGihsa:862
UCSCiuc003yfc.3, human [Q06455-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		862
DisGeNETi862
EuPathDBiHostDB:ENSG00000079102.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		RUNX1T1
HGNCiHGNC:1535, RUNX1T1
HPAiENSG00000079102, Tissue enriched (brain)
MalaCardsiRUNX1T1
MIMi133435, gene
neXtProtiNX_Q06455
OpenTargetsiENSG00000079102
Orphaneti102724, Acute myeloid leukemia with t(8;21)(q22;q22) translocation
PharmGKBiPA26111

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QTD6, Eukaryota
GeneTreeiENSGT00950000183176
HOGENOMiCLU_022077_2_0_1
InParanoidiQ06455
KOiK10053
OrthoDBi334242at2759
PhylomeDBiQ06455
TreeFamiTF106303

Enzyme and pathway databases

PathwayCommonsiQ06455
SIGNORiQ06455

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		862, 3 hits in 877 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RUNX1T1, human
EvolutionaryTraceiQ06455

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RUNX1T1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		862
PharosiQ06455, Tbio

Protein Ontology

More...PROi		PR:Q06455
RNActiQ06455, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000079102, Expressed in forebrain and 239 other tissues
ExpressionAtlasiQ06455, baseline and differential
GenevisibleiQ06455, HS

Family and domain databases

Gene3Di1.20.120.1110, 1 hit
IDEALiIID00381
InterProiView protein in InterPro
IPR013290, CBFA2T1
IPR013289, CBFA2T1/2/3
IPR014896, NHR2
IPR037249, TAFH/NHR1_dom_sf
IPR003894, TAFH_NHR1
IPR002893, Znf_MYND
PANTHERiPTHR10379, PTHR10379, 1 hit
PTHR10379:SF5, PTHR10379:SF5, 1 hit
PfamiView protein in Pfam
PF08788, NHR2, 1 hit
PF07531, TAFH, 1 hit
PF01753, zf-MYND, 1 hit
PRINTSiPR01875, ETOFAMILY
PR01876, MTG8PROTEIN
SMARTiView protein in SMART
SM00549, TAFH, 1 hit
SUPFAMiSSF158553, SSF158553, 1 hit
PROSITEiView protein in PROSITE
PS51119, TAFH, 1 hit
PS01360, ZF_MYND_1, 1 hit
PS50865, ZF_MYND_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTG8_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q06455
Secondary accession number(s): B7Z4P4
, E7EPN4, O14784, Q06456, Q14873, Q16239, Q16346, Q16347, Q6IBL1, Q6NXH1, Q7Z4J5, Q92479, Q9BRZ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: August 12, 2020
This is version 207 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again