Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 96 (17 Jun 2020)
Sequence version 1 (14 Nov 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein inturned

Gene

Intu

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a key role in ciliogenesis and embryonic development. Regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. Plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension. Has an indirect effect on hedgehog signaling (PubMed:20067783, PubMed:21761479). Proposed to function as core component of the CPLANE (ciliogenesis and planar polarity effectors) complex involved in the recruitment of peripheral IFT-A proteins to basal bodies (By similarity).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCilium biogenesis/degradation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5610787 Hedgehog 'off' state

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein inturned
Alternative name(s):
Inturned planar cell polarity effector homolog
PDZ domain-containing protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Intu
Synonyms:Kiaa1284, Pdzd6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443752 Intu

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Embryos die at midgestation. Embryos exhibit multiple defects including neural tube closure defects, abnormal dorsal/ventral patterning of the central nervous system and abnormal anterior-posterior patterning of the limbs resulting in severe polydactyly. Fewer and shorter cilia are present in mutant embryos. In mice lacking both Intu and Fuz, the lack of convergent extension and more severe patterning defects in Intu and Fuz mutants does not result from a functional redundancy between these proteins.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004162831 – 942Protein inturnedAdd BLAST942

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei674PhosphoserineBy similarity1
Modified residuei678PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q059U7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q059U7

PRoteomics IDEntifications database

More...
PRIDEi
Q059U7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q059U7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q059U7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in E8.5 and E9.5 wild type embryos. Present in various adult organs (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000060798 Expressed in spinal cord and 210 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q059U7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CPLANE1.

Interacts with FUZ and WDPCP; FUZ, INTU and WDPCP probably form the core CPLANE (ciliogenesis and planar polarity effectors) complex.

1 Publication

Protein-protein interaction databases

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-5026 CPLANE complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q059U7

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000088725

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q059U7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini185 – 267PDZPROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the inturned family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHJH Eukaryota
ENOG410XR9C LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001301

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_104236_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q059U7

KEGG Orthology (KO)

More...
KOi
K22862

Identification of Orthologs from Complete Genome Data

More...
OMAi
YIRFSLP

Database of Orthologous Groups

More...
OrthoDBi
898612at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q059U7

TreeFam database of animal gene trees

More...
TreeFami
TF323932

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039151 INTU
IPR001478 PDZ
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR21082 PTHR21082, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q059U7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGLARGDSR GRPPELPGDL SSQEEEEEEG DSDAGASSLG SYSSASSDTD
60 70 80 90 100
VEPEWLDSVQ KNGELFYLEL SEDEEESLLP ETQTANHVNH VRFSDKEVII
110 120 130 140 150
EEDDSRERKK SEPKLRRFTK ILKSKSLLPR RHHKKSSSNN GPVSILKHQS
160 170 180 190 200
SQKTGVTVQQ RYKDVTVYIN PRKLTAIKAR EQVKLLEVLV GIIHQTKRSW
210 220 230 240 250
KRSAKQADGE RLVVHGLLPG GSAMKSGQVL VGDVLVAVND VDVTSENIER
260 270 280 290 300
VLSCIPGPMQ VKLTFENAYA VKRETAQPQK KKAQSSTQDL VKLLCGSEAD
310 320 330 340 350
AVQHSTLSIP HISMYLTLQL QSEAAREEQE ILYHYPVSEA SQKLKSVRGI
360 370 380 390 400
FLTLCDMLES VTGTQVTSSS LHLNGKQIHV AYLKESDKLL LIGLPAEEVP
410 420 430 440 450
LPQLRNMIED VAQTLKFMYG SLDSAFCQVE NAPRLDHFFS LFFERALRPG
460 470 480 490 500
KLHLSGSPSA QQYAAASAVL LDNLPGVRWL VLPQELKVEL DTALSDLEAA
510 520 530 540 550
DFEELSEDYY DMRRLYTILG SSLFYKGYMV CSHLPKDDVI EIAAYCRQHC
560 570 580 590 600
LLPLAAKQRI GQLIIWREVF PRHHLQPPSD SDPEAFQEPE GRYFLLVVGL
610 620 630 640 650
RHYLLCVLLE AGGCASKATG NPGPDCIYVD QVRATLHQLE GVDSRIEEQL
660 670 680 690 700
ATSPGPCLSC ADWFLAAPRE KADSLTTSPI LSRLQGPSKT AASPTCRRTF
710 720 730 740 750
FSDYSFKARK PSPSRIGGGR EPTEGEESAG LSPHATPDAV RKQRESEGSD
760 770 780 790 800
DNVALLKLAR KKSTLPNPFH LGTSKKELSE KELEVYDIMK LTSGPENTLF
810 820 830 840 850
HYVALETVQG IFITPTHEEV AQLGGSVHSQ LIKNFHQCCL SIRAFFQQTL
860 870 880 890 900
KEEKKKALSD GEHSEPTNSV SSLSPVKEHG VLFECSPENW TDQKKTPPVM
910 920 930 940
SYWVVGRLFL NPKPQELYVC FHDSVSEIAI EMAFKLFFGL TL
Length:942
Mass (Da):104,821
Last modified:November 14, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC410DF463F0F457F
GO
Isoform 2 (identifier: Q059U7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MAGLARGDSR...GSYSSASSDT → MFQGGGRTSIPKPAPRNLEDLDSVQRVLLHS
     233-247: DVLVAVNDVDVTSEN → KCCSQLPSLFAEVHG
     248-942: Missing.

Show »
Length:229
Mass (Da):25,885
Checksum:i6F7ED730A68336E9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0N4SUY7A0A0N4SUY7_MOUSE
Protein inturned
Intu
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti538D → H in BAC28943 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0426031 – 49MAGLA…ASSDT → MFQGGGRTSIPKPAPRNLED LDSVQRVLLHS in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_042604233 – 247DVLVA…VTSEN → KCCSQLPSLFAEVHG in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_042605248 – 942Missing in isoform 2. 1 PublicationAdd BLAST695

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK040233 mRNA Translation: BAC30547.1
AK035092 mRNA Translation: BAC28943.1
AC146980 Genomic DNA No translation available.
AC163023 Genomic DNA No translation available.
CH466530 Genomic DNA Translation: EDL35133.1
BC125523 mRNA Translation: AAI25524.1
BC132387 mRNA Translation: AAI32388.1
AK122485 mRNA Translation: BAC65767.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS84619.1 [Q059U7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_780724.3, NM_175515.5 [Q059U7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000061590; ENSMUSP00000054313; ENSMUSG00000060798 [Q059U7-2]
ENSMUST00000091186; ENSMUSP00000088725; ENSMUSG00000060798 [Q059U7-1]
ENSMUST00000230028; ENSMUSP00000155476; ENSMUSG00000116357 [Q059U7-2]
ENSMUST00000230501; ENSMUSP00000155551; ENSMUSG00000116357 [Q059U7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
380614

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:380614

UCSC genome browser

More...
UCSCi
uc033htd.1 mouse [Q059U7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK040233 mRNA Translation: BAC30547.1
AK035092 mRNA Translation: BAC28943.1
AC146980 Genomic DNA No translation available.
AC163023 Genomic DNA No translation available.
CH466530 Genomic DNA Translation: EDL35133.1
BC125523 mRNA Translation: AAI25524.1
BC132387 mRNA Translation: AAI32388.1
AK122485 mRNA Translation: BAC65767.1
CCDSiCCDS84619.1 [Q059U7-1]
RefSeqiNP_780724.3, NM_175515.5 [Q059U7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

ComplexPortaliCPX-5026 CPLANE complex
CORUMiQ059U7
STRINGi10090.ENSMUSP00000088725

PTM databases

iPTMnetiQ059U7
PhosphoSitePlusiQ059U7

Proteomic databases

MaxQBiQ059U7
PaxDbiQ059U7
PRIDEiQ059U7

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26899 75 antibodies

Genome annotation databases

EnsembliENSMUST00000061590; ENSMUSP00000054313; ENSMUSG00000060798 [Q059U7-2]
ENSMUST00000091186; ENSMUSP00000088725; ENSMUSG00000060798 [Q059U7-1]
ENSMUST00000230028; ENSMUSP00000155476; ENSMUSG00000116357 [Q059U7-2]
ENSMUST00000230501; ENSMUSP00000155551; ENSMUSG00000116357 [Q059U7-1]
GeneIDi380614
KEGGimmu:380614
UCSCiuc033htd.1 mouse [Q059U7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27152
MGIiMGI:2443752 Intu

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410IHJH Eukaryota
ENOG410XR9C LUCA
GeneTreeiENSGT00390000001301
HOGENOMiCLU_104236_0_0_1
InParanoidiQ059U7
KOiK22862
OMAiYIRFSLP
OrthoDBi898612at2759
PhylomeDBiQ059U7
TreeFamiTF323932

Enzyme and pathway databases

ReactomeiR-MMU-5610787 Hedgehog 'off' state

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
380614 0 hits in 6 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Intu mouse

Protein Ontology

More...
PROi
PR:Q059U7
RNActiQ059U7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000060798 Expressed in spinal cord and 210 other tissues
GenevisibleiQ059U7 MM

Family and domain databases

Gene3Di2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR039151 INTU
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR21082 PTHR21082, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiINTU_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q059U7
Secondary accession number(s): Q80TG0, Q8BS60, Q8C9Y0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2012
Last sequence update: November 14, 2006
Last modified: June 17, 2020
This is version 96 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again