Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (16 Oct 2019)
Sequence version 2 (24 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Formin-1

Gene

Fmn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the formation of adherens junction and the polymerization of linear actin cables.2 Publications

Miscellaneous

Was originally thought to play a role in limb bud development based on the fact that limb deformity (ld) mutants are associated with Fmn1 gene disruption. However, PubMed:15198975 shows that limb deformity mutations rather affects Grem1 cis-regulatory regions localized in Fmn1 gene and that loss of Grem1 (gremlin-1) expression is the cause of limb malformations.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: UniProtKB-KW
  • microtubule binding Source: MGI
  • SH3 domain binding Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Formin-1
Alternative name(s):
Limb deformity protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fmn1
Synonyms:Fmn, Ld
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:101815 Fmn1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001948861 – 1466Formin-1Add BLAST1466

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine and possibly threonine residues.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q05860

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q05860

PeptideAtlas

More...
PeptideAtlasi
Q05860

PRoteomics IDEntifications database

More...
PRIDEi
Q05860

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q05860

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q05860

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

It is present in the adult kidney, testis, limb, ovary, brain, small intestine, salivary gland and harderian gland. Isoforms 1, 2 and 5 are detected in skin and keratinocytes. Isoform 5 is found throughout the embryo.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

It is present throughout the embryo. In the developing limb bud, the protein is expressed in the apical ectodermal ridge and the mesenchymal compartment, predominantly in the posterior region. During kidney morphogenesis, expression is initially restricted to the epithelial compartment of the pronephros and mesonephros. Isoform 5 is found in the apical ectodermal ridge and the mesenchymal compartment of the developing limb bud.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000044042 Expressed in 197 organ(s), highest expression level in substantia nigra

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q05860 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q05860 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with alpha-catenin and may interact with tubulin.

2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
199711, 6 interactors

Database of interacting proteins

More...
DIPi
DIP-646N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q05860

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099606

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q05860

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q05860

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini870 – 970FH1Add BLAST101
Domaini983 – 1435FH2PROSITE-ProRule annotationAdd BLAST453

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 624Microtubule-bindingAdd BLAST624
Regioni458 – 842Mediates interaction with alpha-cateninAdd BLAST385

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili722 – 786Sequence analysisAdd BLAST65

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi870 – 995Pro-richAdd BLAST126

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1922 Eukaryota
ENOG410XQWC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154289

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168579

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q05860

KEGG Orthology (KO)

More...
KOi
K10367

Identification of Orthologs from Complete Genome Data

More...
OMAi
QKCFEET

Database of Orthologous Groups

More...
OrthoDBi
249504at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q05860

TreeFam database of animal gene trees

More...
TreeFami
TF351317

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.58.2220, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015425 FH2_Formin
IPR042201 FH2_Formin_sf
IPR001265 Formin_Cappuccino_subfam

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02181 FH2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00828 FORMIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00498 FH2, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51444 FH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q05860-1) [UniParc]FASTAAdd to basket
Also known as: IA

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGTHCTLQL HNPIAELCYI SFYLPKGEVR GFSYKGTVTL DRSNNAFHNC
60 70 80 90 100
YQVREGPDIT SLSQQPNEHP GDIFFKQTPT KNILTELYKL TAEKERLLDS
110 120 130 140 150
LLRSDNILGV SMGSQEGKLQ ELSVILATGD EYFQSAGNWR RELPVSSLIR
160 170 180 190 200
RSTQENKKPR RSGRRRESPE ELRQKRTRRK GRGCQESAFQ MGKDQVCSSS
210 220 230 240 250
SLSFRARPNL RLLEERGNLV PRGTLTSSLR RRESCPANIL RTPDADLAFG
260 270 280 290 300
NSGRTSEDTD LEGPLSPDSS PTEVGDADVG GQLKSSHQQE PPQPNVSESH
310 320 330 340 350
GKHAGAERWS SRTRKSKSLE RTCSKKPVSK VVAKIQEPSA PVKRIVRAHH
360 370 380 390 400
DGKGRVAYGP ETQTEFIPKA DFLTLPGGET ETHSSGRLEE EQPGIKSLRS
410 420 430 440 450
SAPERASITK EPASTEAAVN KVLRKVIESE KLDEATEGKR LGFSLNTRAT
460 470 480 490 500
HTFPETRSQR KAGLPQSGHK FLLLDLPHTV GPDSPQPKCD EKKPTPQVPT
510 520 530 540 550
ALGMVFNNSS PQSSAHKRLS PVPSPLSPRC PSPQQHHRIL LLPPLPSEGE
560 570 580 590 600
VVFNEYPSRK NDVSSGFPSA DTLEPSSTTK VTETKGASPT SLRASQTWLV
610 620 630 640 650
SEEASEKGLG PEKITAPPQH QLPPGIASEG FPCDNFKEQT AKDLPNKDGG
660 670 680 690 700
VWVPGYRAGP PCPFLLHEEK EKTSRSELYL DLNPDQSPTE QDDRTPGRLQ
710 720 730 740 750
AVWPPPKTKD TEEKVGLKYT EAEYQAAILH LKREHKEEIE TLQAQFELKT
760 770 780 790 800
FHIRGEHALV TARLEEAIEN LKQQLGKRRE GCEEMRDVCI STDDDCSPKA
810 820 830 840 850
FRNVCIQTDR ETFLKPCDAE SKATRSSQIV PKKLTISLTQ LSPSKDSKDI
860 870 880 890 900
HAPFQTREGT SSSSQHKISP PAPPTPPPLP PPLIPPPPPL PPGLGPLPPA
910 920 930 940 950
PPIPPVCPVS PPPPPPPPPP TPVPPSDGPP PPPPPPPPLP NVLALPNSGG
960 970 980 990 1000
PPPPPPPPPP GLAPPPPPGL SFGLSSSSSQ YPRKPAIEPS CPMKPLYWTR
1010 1020 1030 1040 1050
IQINDKSQDA APTLWDSLEE PHIRDTSEFE YLFSKDTTQQ KKKPLSEAYE
1060 1070 1080 1090 1100
KKNKVKKIIK LLDGKRSQTV GILISSLHLE MKDIQQAIFT VDDSVVDLET
1110 1120 1130 1140 1150
LAALYENRAQ EDELTKIRKY YETSKEEDLK LLDKPEQFLH ELAQIPNFAE
1160 1170 1180 1190 1200
RAQCIIFRAV FSEGITSLHR KVEIVTRASK GLLHMKSVKD ILALILAFGN
1210 1220 1230 1240 1250
YMNGGNRTRG QADGYSLEIL PKLKDVKSRD NGMNLVDYVV KYYLRYYDQC
1260 1270 1280 1290 1300
KHHDQEASCR GKDLFSLYFH IAVHPQRKSG LELKQEAGTD KSVFPLPEPQ
1310 1320 1330 1340 1350
DFFLASQVKF EDLLKDLRKL KRQLEASEQQ MKLVCKESPR EYLQPFKDKL
1360 1370 1380 1390 1400
EEFFKKAKKE HKMEESHLEN AQKSFETTVG YFGMKPKTGE KEVTPSYVFM
1410 1420 1430 1440 1450
VWFEFCSDFK TIWKRESKNI SKERLKMAQA SVSKLTSEKK VETKKINPTA
1460
SLKERLRQKE ASVATN
Length:1,466
Mass (Da):163,581
Last modified:July 24, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5482F8AAB66CBF32
GO
Isoform 2 (identifier: Q05860-2) [UniParc]FASTAAdd to basket
Also known as: IB

The sequence of this isoform differs from the canonical sequence as follows:
     1250-1285: Missing.

Show »
Length:1,430
Mass (Da):159,391
Checksum:i6A90287624580946
GO
Isoform 3 (identifier: Q05860-3) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     625-722: Missing.

Show »
Length:1,368
Mass (Da):152,641
Checksum:iF34DEB5CF39489AA
GO
Isoform 4 (identifier: Q05860-4) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     626-627: IA → SV
     628-1466: Missing.

Show »
Length:627
Mass (Da):68,996
Checksum:iF25AF953C733E24F
GO
Isoform 5 (identifier: Q05860-5) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     1-682: Missing.
     683-683: N → MEEVGNSLSS...PADSPSDPKS
     1250-1285: Missing.

Show »
Length:1,204
Mass (Da):133,207
Checksum:i8724170303A83D33
GO
Isoform 6 (identifier: Q05860-6) [UniParc]FASTAAdd to basket
Also known as: V

The sequence of this isoform differs from the canonical sequence as follows:
     1-623: Missing.
     624-624: P → MVTTGSPPFNTMGACYRYNPRYGQPISVPKVWKCRHRRSVTPDE
     1250-1285: Missing.

Show »
Length:850
Mass (Da):95,723
Checksum:i173EC42FD49F66D9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q7P6E9Q7P6_MOUSE
Formin-1
Fmn1
1,332Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti220V → A in CAA37668 (PubMed:2392150).Curated1
Sequence conflicti776G → E in CAA37668 (PubMed:2392150).Curated1
Sequence conflicti776G → E in CAA44244 (PubMed:1339380).Curated1
Sequence conflicti866H → Q in CAA37668 (PubMed:2392150).Curated1
Sequence conflicti866H → Q in CAA44244 (PubMed:1339380).Curated1
Sequence conflicti950G → GPP in CAA37668 (PubMed:2392150).Curated1
Sequence conflicti950G → GPP in CAA44244 (PubMed:1339380).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0272141 – 682Missing in isoform 5. 1 PublicationAdd BLAST682
Alternative sequenceiVSP_0294241 – 623Missing in isoform 6. CuratedAdd BLAST623
Alternative sequenceiVSP_029425624P → MVTTGSPPFNTMGACYRYNP RYGQPISVPKVWKCRHRRSV TPDE in isoform 6. Curated1
Alternative sequenceiVSP_001570625 – 722Missing in isoform 3. CuratedAdd BLAST98
Alternative sequenceiVSP_001571626 – 627IA → SV in isoform 4. Curated2
Alternative sequenceiVSP_001572628 – 1466Missing in isoform 4. CuratedAdd BLAST839
Alternative sequenceiVSP_027215683N → MEEVGNSLSSRDVLEPDKSE AGLEMAQSILSKFSMKSLFG FTNKLDSLEPEEEDAVLKAF RSLEGDPAPERGDPSKGSDQ PQAEAPVPPDLKNDGKSARA ETGSEGSQGKGRSNTSSPGY ELSPATVSVDNEEVIWVRGT LVHTTSDSDSEDGDQEAEEE SSLDTQKPTTVVLCEPSQEP KDRAGDSEENTDTGNTDDTE LCAEESQRTLPETSSKLELG GDGSHPAEHSPRQDQAAEEG SQIPPAATDQTVGALASTVS KREAPEEKPFQLPAFFSGLR VLKKGATAEAGETITEIKPK DGDLALLKLTQRVQKSLGQG GPQTVKSPGRATDPKATPTL LEQLSQLLNIDMPRTEQKEA DPEFHGADEMGYSTDQESHK SPRDAHVQGGQVKARTPETA LEAFKALFIRPPKKGSTADT SELEALKRKMKHEKESLRAV FERSKSRPADSPSDPKS in isoform 5. 1 Publication1
Alternative sequenceiVSP_0272161250 – 1285Missing in isoform 2, isoform 5 and isoform 6. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X53599 mRNA Translation: CAA37668.1
X62379 mRNA Translation: CAA44244.1
AL672253 Genomic DNA No translation available.
AL691437 Genomic DNA No translation available.
AL691466 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16559.1 [Q05860-1]
CCDS71113.1 [Q05860-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
S11515
S24407

NCBI Reference Sequences

More...
RefSeqi
NP_001272388.1, NM_001285459.1 [Q05860-5]
NP_034360.2, NM_010230.2 [Q05860-1]
XP_011237596.1, XM_011239294.1 [Q05860-2]
XP_011237597.1, XM_011239295.1 [Q05860-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000081349; ENSMUSP00000080093; ENSMUSG00000044042 [Q05860-5]
ENSMUST00000099576; ENSMUSP00000097171; ENSMUSG00000044042 [Q05860-2]
ENSMUST00000102547; ENSMUSP00000099606; ENSMUSG00000044042 [Q05860-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14260

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14260

UCSC genome browser

More...
UCSCi
uc008lpk.1 mouse [Q05860-4]
uc008lpl.1 mouse [Q05860-1]
uc008lpn.2 mouse [Q05860-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X53599 mRNA Translation: CAA37668.1
X62379 mRNA Translation: CAA44244.1
AL672253 Genomic DNA No translation available.
AL691437 Genomic DNA No translation available.
AL691466 Genomic DNA No translation available.
CCDSiCCDS16559.1 [Q05860-1]
CCDS71113.1 [Q05860-5]
PIRiS11515
S24407
RefSeqiNP_001272388.1, NM_001285459.1 [Q05860-5]
NP_034360.2, NM_010230.2 [Q05860-1]
XP_011237596.1, XM_011239294.1 [Q05860-2]
XP_011237597.1, XM_011239295.1 [Q05860-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JUPNMR-P881-888[»]
2RLYNMR-P874-881[»]
2RM0NMR-P880-888[»]
SMRiQ05860
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi199711, 6 interactors
DIPiDIP-646N
ELMiQ05860
STRINGi10090.ENSMUSP00000099606

PTM databases

iPTMnetiQ05860
PhosphoSitePlusiQ05860

Proteomic databases

MaxQBiQ05860
PaxDbiQ05860
PeptideAtlasiQ05860
PRIDEiQ05860

Genome annotation databases

EnsembliENSMUST00000081349; ENSMUSP00000080093; ENSMUSG00000044042 [Q05860-5]
ENSMUST00000099576; ENSMUSP00000097171; ENSMUSG00000044042 [Q05860-2]
ENSMUST00000102547; ENSMUSP00000099606; ENSMUSG00000044042 [Q05860-1]
GeneIDi14260
KEGGimmu:14260
UCSCiuc008lpk.1 mouse [Q05860-4]
uc008lpl.1 mouse [Q05860-1]
uc008lpn.2 mouse [Q05860-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
342184
MGIiMGI:101815 Fmn1

Phylogenomic databases

eggNOGiKOG1922 Eukaryota
ENOG410XQWC LUCA
GeneTreeiENSGT00940000154289
HOGENOMiHOG000168579
InParanoidiQ05860
KOiK10367
OMAiQKCFEET
OrthoDBi249504at2759
PhylomeDBiQ05860
TreeFamiTF351317

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fmn1 mouse
EvolutionaryTraceiQ05860

Protein Ontology

More...
PROi
PR:Q05860

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000044042 Expressed in 197 organ(s), highest expression level in substantia nigra
ExpressionAtlasiQ05860 baseline and differential
GenevisibleiQ05860 MM

Family and domain databases

Gene3Di1.20.58.2220, 2 hits
InterProiView protein in InterPro
IPR015425 FH2_Formin
IPR042201 FH2_Formin_sf
IPR001265 Formin_Cappuccino_subfam
PfamiView protein in Pfam
PF02181 FH2, 1 hit
PRINTSiPR00828 FORMIN
SMARTiView protein in SMART
SM00498 FH2, 1 hit
PROSITEiView protein in PROSITE
PS51444 FH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFMN1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q05860
Secondary accession number(s): A2AFY9, A2AFZ0, Q05859
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 24, 2007
Last modified: October 16, 2019
This is version 150 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again