Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (02 Jun 2021)
Sequence version 4 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Beta-adducin

Gene

Add2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-5223345, Miscellaneous transport and binding events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta-adducin
Alternative name(s):
Adducin-63
Erythrocyte adducin subunit beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Add2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Rat genome database

More...
RGDi
2042, Add2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002185351 – 725Beta-adducinAdd BLAST725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei11PhosphoserineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei55PhosphothreonineBy similarity1
Modified residuei60PhosphoserineCombined sources1
Modified residuei344PhosphoserineBy similarity1
Modified residuei530PhosphoserineCombined sources1
Modified residuei532PhosphoserineCombined sources1
Modified residuei533PhosphothreonineBy similarity1
Modified residuei535PhosphoserineBy similarity1
Modified residuei594PhosphoserineCombined sources1
Modified residuei598PhosphoserineBy similarity1
Modified residuei602PhosphoserineCombined sources1
Modified residuei606PhosphoserineBy similarity1
Modified residuei612PhosphothreonineBy similarity1
Modified residuei614PhosphoserineCombined sources1
Modified residuei618PhosphoserineCombined sources1
Modified residuei620PhosphoserineBy similarity1
Modified residuei674PhosphothreonineCombined sources1
Modified residuei678PhosphoserineCombined sources1
Modified residuei685PhosphoserineCombined sources1
Modified residuei688PhosphoserineCombined sources1
Modified residuei692PhosphoserineCombined sources1
Modified residuei696PhosphoserineBy similarity1
Modified residuei698PhosphoserineBy similarity1
Modified residuei700PhosphoserineBy similarity1
Modified residuei702PhosphoserineBy similarity1
Modified residuei712PhosphoserineBy similarity1
Isoform 2 (identifier: Q05764-2)
Modified residuei561PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q05764

PRoteomics IDEntifications database

More...
PRIDEi
Q05764

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q05764

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q05764

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in liver, kidney, spleen, heart and brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000015903, Expressed in frontal cortex and 19 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q05764, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit.

Found in a complex with ADD2, DMTN and SLC2A1.

Interacts with SLC2A1 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
246361, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q05764, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000021491

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q05764

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 22DisorderedSequence analysisAdd BLAST22
Regioni425 – 444Interaction with calmodulinSequence analysisAdd BLAST20
Regioni525 – 725DisorderedSequence analysisAdd BLAST201
Regioni703 – 720Interaction with calmodulinSequence analysisAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi525 – 539Polar residuesSequence analysisAdd BLAST15
Compositional biasi563 – 591Basic and acidic residuesSequence analysisAdd BLAST29
Compositional biasi595 – 619Polar residuesSequence analysisAdd BLAST25
Compositional biasi623 – 659Basic and acidic residuesSequence analysisAdd BLAST37
Compositional biasi683 – 698Polar residuesSequence analysisAdd BLAST16
Compositional biasi702 – 716Basic residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3699, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159299

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q05764

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q05764

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.225.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027773, ADD2
IPR001303, Aldolase_II/adducin_N
IPR036409, Aldolase_II/adducin_N_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10672:SF6, PTHR10672:SF6, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00596, Aldolase_II, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01007, Aldolase_II, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53639, SSF53639, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q05764-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ
60 70 80 90 100
KKRVTMILQS PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA
110 120 130 140 150
VFPASSMNFS MMTPINDLHT ADSLNLAKGE RLMRCKISSV YRLLDLYGWA
160 170 180 190 200
QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV TASSLIKVNI LGEVVEKGSS
210 220 230 240 250
CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK CGLLPVSHNA
260 270 280 290 300
LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE
310 320 330 340 350
EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS
360 370 380 390 400
TFGPMQKSRL GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI
410 420 430 440 450
PATVTAFVFE EDGVPVPALR QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ
460 470 480 490 500
RNMGSPRPKT TWMKADEVEK SSSGMPIRIE NPNQFVPLYT DPQEVLDMRN
510 520 530 540 550
KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLASK GDADTKDELE
560 570 580 590 600
ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDAATE EPGSPVKSTP
610 620 630 640 650
ASPVQSPTRA GTKSPAVSPS KASEDAKKTE VSEANTEPEP EKPEGVVVNG
660 670 680 690 700
KEEEPCVEEV LSKGPGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS
710 720
PSKKKKKFRT PSFLKKSKKK EKVES
Length:725
Mass (Da):80,593
Last modified:January 23, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0715BD6A75B3D174
GO
Isoform 2 (identifier: Q05764-2) [UniParc]FASTAAdd to basket
Also known as: Adducin 63

The sequence of this isoform differs from the canonical sequence as follows:
     532-562: STESQLASKGDADTKDELEETVPNPFSQLTD → VQQRLPPTEGEAYQTPGAGQGTPESSGPLTP
     563-725: Missing.

Show »
Length:562
Mass (Da):62,788
Checksum:iAECF299694E44CB8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WFS9F8WFS9_RAT
Beta-adducin
Add2
725Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti529R → Q in strain: Milan hypertensive. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000186532 – 562STESQ…SQLTD → VQQRLPPTEGEAYQTPGAGQ GTPESSGPLTP in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_000187563 – 725Missing in isoform 2. 1 PublicationAdd BLAST163

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M63894 mRNA Translation: AAA40679.1
AF130338 mRNA Translation: AAF31764.1

Protein sequence database of the Protein Information Resource

More...
PIRi
JQ1036

NCBI Reference Sequences

More...
RefSeqi
NP_001103350.1, NM_001109880.1
NP_036623.1, NM_012491.2 [Q05764-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000081173; ENSRNOP00000073973; ENSRNOG00000015903 [Q05764-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
24171

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:24171

UCSC genome browser

More...
UCSCi
RGD:2042, rat [Q05764-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M63894 mRNA Translation: AAA40679.1
AF130338 mRNA Translation: AAF31764.1
PIRiJQ1036
RefSeqiNP_001103350.1, NM_001109880.1
NP_036623.1, NM_012491.2 [Q05764-2]

3D structure databases

SMRiQ05764
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi246361, 3 interactors
IntActiQ05764, 1 interactor
STRINGi10116.ENSRNOP00000021491

PTM databases

iPTMnetiQ05764
PhosphoSitePlusiQ05764

Proteomic databases

PaxDbiQ05764
PRIDEiQ05764

Genome annotation databases

EnsembliENSRNOT00000081173; ENSRNOP00000073973; ENSRNOG00000015903 [Q05764-2]
GeneIDi24171
KEGGirno:24171
UCSCiRGD:2042, rat [Q05764-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
119
RGDi2042, Add2

Phylogenomic databases

eggNOGiKOG3699, Eukaryota
GeneTreeiENSGT00940000159299
InParanoidiQ05764
PhylomeDBiQ05764

Enzyme and pathway databases

ReactomeiR-RNO-5223345, Miscellaneous transport and binding events

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q05764

Gene expression databases

BgeeiENSRNOG00000015903, Expressed in frontal cortex and 19 other tissues
ExpressionAtlasiQ05764, baseline and differential

Family and domain databases

Gene3Di3.40.225.10, 1 hit
InterProiView protein in InterPro
IPR027773, ADD2
IPR001303, Aldolase_II/adducin_N
IPR036409, Aldolase_II/adducin_N_sf
PANTHERiPTHR10672:SF6, PTHR10672:SF6, 1 hit
PfamiView protein in Pfam
PF00596, Aldolase_II, 1 hit
SMARTiView protein in SMART
SM01007, Aldolase_II, 1 hit
SUPFAMiSSF53639, SSF53639, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADDB_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q05764
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: January 23, 2007
Last modified: June 2, 2021
This is version 153 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again