Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q05397 (FAK1_HUMAN)

Entry version 243 (10 Feb 2021)
Sequence version 2 (15 Jul 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Focal adhesion kinase 1

Gene

PTK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.23 Publications
Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Subject to autoinhibition, mediated by interactions between the FERM domain and the kinase domain. Activated by autophosphorylation at Tyr-397. This promotes interaction with SRC and phosphorylation at Tyr-576 and Tyr-577 in the kinase activation loop. Phosphorylation at Tyr-576 and Tyr-577 is required for maximal kinase activity. Inhibited by TAC544, TAE226, PF-573,228 and PF-562,271.6 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei454ATPPROSITE-ProRule annotation1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei546Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi428 – 434ATPPROSITE-ProRule annotation1 Publication7
Nucleotide bindingi500 – 502ATPPROSITE-ProRule annotation1 Publication3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Kinase, Transferase, Tyrosine-protein kinase
Biological processAngiogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.10.2, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q05397

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111465, Apoptotic cleavage of cellular proteins
R-HSA-2029482, Regulation of actin dynamics for phagocytic cup formation
R-HSA-354192, Integrin signaling
R-HSA-354194, GRB2:SOS provides linkage to MAPK signaling for Integrins
R-HSA-372708, p130Cas linkage to MAPK signaling for integrins
R-HSA-375165, NCAM signaling for neurite out-growth
R-HSA-391160, Signal regulatory protein family interactions
R-HSA-3928662, EPHB-mediated forward signaling
R-HSA-418885, DCC mediated attractive signaling
R-HSA-4420097, VEGFA-VEGFR2 Pathway
R-HSA-5663213, RHO GTPases Activate WASPs and WAVEs
R-HSA-5673001, RAF/MAP kinase cascade
R-HSA-8874081, MET activates PTK2 signaling
R-HSA-9009391, Extra-nuclear estrogen signaling
R-HSA-9634638, Estrogen-dependent nuclear events downstream of ESR-membrane signaling
R-HSA-9664422, FCGR3A-mediated phagocytosis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q05397

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q05397

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Focal adhesion kinase 1Curated (EC:2.7.10.2)
Short name:
FADK 1
Alternative name(s):
Focal adhesion kinase-related nonkinase
Short name:
FRNK
Protein phosphatase 1 regulatory subunit 71
Short name:
PPP1R71
Protein-tyrosine kinase 2
p125FAK
pp125FAK
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTK2Imported
Synonyms:FAK, FAK1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9611, PTK2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600758, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q05397

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000169398.19

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Aberrant PTK2/FAK1 expression may play a role in cancer cell proliferation, migration and invasion, in tumor formation and metastasis. PTK2/FAK1 overexpression is seen in many types of cancer.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi397Y → F: Abolishes autophosphorylation. Abolishes interaction with SRC and activation of BMX. 1 Publication1
Mutagenesisi928V → G: Loss of interaction with TGFB1I1. 1 Publication1
Mutagenesisi1034L → S: Loss of interaction with TGFB1I1. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5747

Open Targets

More...OpenTargetsi		ENSG00000169398

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33955

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q05397, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2695

Drug and drug target database

More...DrugBanki		DB07460, 2-({5-CHLORO-2-[(2-METHOXY-4-MORPHOLIN-4-YLPHENYL)AMINO]PYRIMIDIN-4-YL}AMINO)-N-METHYLBENZAMIDE
DB07248, 7-PYRIDIN-2-YL-N-(3,4,5-TRIMETHOXYPHENYL)-7H-PYRROLO[2,3-D]PYRIMIDIN-2-AMINE
DB06423, Endostatin
DB12010, Fostamatinib

DrugCentral

More...DrugCentrali		Q05397

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		2180

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PTK2

Domain mapping of disease mutations (DMDM)

More...DMDMi		3183518

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000880772 – 1052Focal adhesion kinase 1Add BLAST1051

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei5PhosphotyrosineCombined sources1
Modified residuei13PhosphothreonineCombined sources1
Modified residuei29PhosphoserineCombined sources1
Modified residuei54PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki152Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
Modified residuei397Phosphotyrosine; by autocatalysisCombined sources6 Publications1
Modified residuei407Phosphotyrosine2 Publications1
Modified residuei570PhosphotyrosineCombined sources1
Modified residuei576Phosphotyrosine; by RET and SRC3 Publications1
Modified residuei577Phosphotyrosine; by RET and SRC3 Publications1
Modified residuei580PhosphoserineCombined sources1
Modified residuei722Phosphoserine1 Publication1
Modified residuei732Phosphoserine; by CDK5By similarity1
Modified residuei843PhosphoserineCombined sources1
Modified residuei861Phosphotyrosine3 Publications1
Modified residuei887PhosphoserineCombined sources1
Modified residuei910PhosphoserineCombined sources1
Modified residuei914PhosphothreonineCombined sources1
Modified residuei925Phosphotyrosine2 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues upon activation, e.g. upon integrin signaling. Tyr-397 is the major autophosphorylation site, but other kinases can also phosphorylate this residue. Phosphorylation at Tyr-397 promotes interaction with SRC and SRC family members, leading to phosphorylation at Tyr-576, Tyr-577 and at additional tyrosine residues. FGR promotes phosphorylation at Tyr-397 and Tyr-576. FER promotes phosphorylation at Tyr-577, Tyr-861 and Tyr-925, even when cells are not adherent. Tyr-397, Tyr-576 and Ser-722 are phosphorylated only when cells are adherent. Phosphorylation at Tyr-397 is important for interaction with BMX, PIK3R1 and SHC1. Phosphorylation at Tyr-925 is important for interaction with GRB2. Dephosphorylated by PTPN11; PTPN11 is recruited to PTK2 via EPHA2 (tyrosine phosphorylated). Microtubule-induced dephosphorylation at Tyr-397 is crucial for the induction of focal adhesion disassembly; this dephosphorylation could be catalyzed by PTPN11 and regulated by ZFYVE21. Phosphorylation on tyrosine residues is enhanced by NTN1 (By similarity).By similarity7 Publications
Sumoylated; this enhances autophosphorylation.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1785

Encyclopedia of Proteome Dynamics

More...EPDi		Q05397

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q05397

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q05397

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q05397

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q05397

PeptideAtlas

More...PeptideAtlasi		Q05397

PRoteomics IDEntifications database

More...PRIDEi		Q05397

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		58320 [Q05397-1]
58321 [Q05397-2]
58322 [Q05397-3]
58323 [Q05397-4]
58324 [Q05397-5]
58325 [Q05397-6]
71210

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		Q05397

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q05397

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q05397

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Expressed in epithelial cells (at protein level) (PubMed:31630787).5 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected in cultured cells, immediately after seeding and before formation of focal adhesions (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169398, Expressed in corpus callosum and 241 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q05397, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q05397, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000169398, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via first Pro-rich region) with CAS family members (via SH3 domain), including BCAR1, BCAR3, CASS4 and NEDD9.

Interacts with GIT1.

Interacts with SORBS1.

Interacts with ARHGEF28.

Interacts with SHB.

Part of a complex composed of THSD1, PTK2/FAK1, TLN1 and VCL (PubMed:29069646).

Interacts with PXN and TLN1.

Interacts with STAT1.

Interacts with DCC.

Interacts with WASL.

Interacts with ARHGEF7.

Interacts with GRB2 and GRB7 (By similarity).

Component of a complex that contains at least FER, CTTN and PTK2/FAK1.

Interacts with BMX.

Interacts with TGFB1I1.

Interacts with STEAP4.

Interacts with ZFYVE21.

Interacts with ESR1.

Interacts with PIK3R1 or PIK3R2.

Interacts with SRC, FGR, FLT4 and RET.

Interacts with EPHA2 in resting cells; activation of EPHA2 recruits PTPN11, leading to dephosphorylation of PTK2/FAK1 and dissociation of the complex.

Interacts with EPHA1 (kinase activity-dependent).

Interacts with CD4; this interaction requires the presence of HIV-1 gp120.

Interacts with PIAS1.

Interacts with ARHGAP26 and SHC1.

Interacts with RB1CC1; this inhibits PTK2/FAK1 activity and activation of downstream signaling pathways.

Interacts with P53/TP53 and MDM2.

Interacts with LPXN (via LD motif 3).

Interacts with MISP.

Interacts with CIB1 isoform 2.

Interacts with CD36.

Interacts with EMP2; regulates PTK2 activation and localization (PubMed:19494199).

Interacts with DSCAM (By similarity).

By similarity28 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111719, 146 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q05397

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q05397

Protein interaction database and analysis system

More...IntActi		Q05397, 88 interactors

Molecular INTeraction database

More...MINTi		Q05397

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000341189

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q05397

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q05397, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11052
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q05397

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q05397

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 355FERMPROSITE-ProRule annotationAdd BLAST321
Domaini422 – 680Protein kinasePROSITE-ProRule annotationAdd BLAST259

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni707 – 1052Interaction with TGFB1I1Add BLAST346
Regioni912 – 1052Interaction with ARHGEF28By similarityAdd BLAST141

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi712 – 733Pro-richAdd BLAST22
Compositional biasi863 – 913Pro-richAdd BLAST51

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Pro-rich regions interact with the SH3 domain of CAS family members, such as BCAR1 and NEDD9, and with the GTPase activating protein ARHGAP26.
The carboxy-terminal region is the site of focal adhesion targeting (FAT) sequence which mediates the localization of FAK1 to focal adhesions.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4257, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155113

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002646_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q05397

Database of Orthologous Groups

More...OrthoDBi		43729at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q05397

TreeFam database of animal gene trees

More...TreeFami		TF316643

Family and domain databases

Conserved Domains Database

More...CDDi		cd14473, FERM_B-lobe, 1 hit
cd13190, FERM_C_FAK1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.80.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019749, Band_41_domain
IPR041390, FADK_N
IPR041784, FAK1/PYK2_FERM_C
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR000299, FERM_domain
IPR036137, Focal_adhe_kin_target_dom_sf
IPR005189, Focal_adhesion_kin_target_dom
IPR011009, Kinase-like_dom_sf
IPR011993, PH-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008266, Tyr_kinase_AS
IPR020635, Tyr_kinase_cat_dom
IPR029071, Ubiquitin-like_domsf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00373, FERM_M, 1 hit
PF18038, FERM_N_2, 1 hit
PF03623, Focal_AT, 1 hit
PF07714, PK_Tyr_Ser-Thr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00109, TYRKINASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00295, B41, 1 hit
SM00219, TyrKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47031, SSF47031, 1 hit
SSF54236, SSF54236, 1 hit
SSF56112, SSF56112, 1 hit
SSF68993, SSF68993, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00661, FERM_2, 1 hit
PS50057, FERM_3, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00109, PROTEIN_KINASE_TYR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 32 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q05397-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAYLDPNL NHTPNSSTKT HLGTGMERSP GAMERVLKVF HYFESNSEPT 
        60         70         80         90        100
TWASIIRHGD ATDVRGIIQK IVDSHKVKHV ACYGFRLSHL RSEEVHWLHV 
       110        120        130        140        150
DMGVSSVREK YELAHPPEEW KYELRIRYLP KGFLNQFTED KPTLNFFYQQ 
       160        170        180        190        200
VKSDYMLEIA DQVDQEIALK LGCLEIRRSY WEMRGNALEK KSNYEVLEKD 
       210        220        230        240        250
VGLKRFFPKS LLDSVKAKTL RKLIQQTFRQ FANLNREESI LKFFEILSPV 
       260        270        280        290        300
YRFDKECFKC ALGSSWIISV ELAIGPEEGI SYLTDKGCNP THLADFTQVQ 
       310        320        330        340        350
TIQYSNSEDK DRKGMLQLKI AGAPEPLTVT APSLTIAENM ADLIDGYCRL 
       360        370        380        390        400
VNGTSQSFII RPQKEGERAL PSIPKLANSE KQGMRTHAVS VSETDDYAEI 
       410        420        430        440        450
IDEEDTYTMP STRDYEIQRE RIELGRCIGE GQFGDVHQGI YMSPENPALA 
       460        470        480        490        500
VAIKTCKNCT SDSVREKFLQ EALTMRQFDH PHIVKLIGVI TENPVWIIME 
       510        520        530        540        550
LCTLGELRSF LQVRKYSLDL ASLILYAYQL STALAYLESK RFVHRDIAAR 
       560        570        580        590        600
NVLVSSNDCV KLGDFGLSRY MEDSTYYKAS KGKLPIKWMA PESINFRRFT 
       610        620        630        640        650
SASDVWMFGV CMWEILMHGV KPFQGVKNND VIGRIENGER LPMPPNCPPT 
       660        670        680        690        700
LYSLMTKCWA YDPSRRPRFT ELKAQLSTIL EEEKAQQEER MRMESRRQAT 
       710        720        730        740        750
VSWDSGGSDE APPKPSRPGY PSPRSSEGFY PSPQHMVQTN HYQVSGYPGS 
       760        770        780        790        800
HGITAMAGSI YPGQASLLDQ TDSWNHRPQE IAMWQPNVED STVLDLRGIG 
       810        820        830        840        850
QVLPTHLMEE RLIRQQQEME EDQRWLEKEE RFLKPDVRLS RGSIDREDGS 
       860        870        880        890        900
LQGPIGNQHI YQPVGKPDPA APPKKPPRPG APGHLGSLAS LSSPADSYNE 
       910        920        930        940        950
GVKLQPQEIS PPPTANLDRS NDKVYENVTG LVKAVIEMSS KIQPAPPEEY 
       960        970        980        990       1000
VPMVKEVGLA LRTLLATVDE TIPLLPASTH REIEMAQKLL NSDLGELINK 
      1010       1020       1030       1040       1050
MKLAQQYVMT SLQQEYKKQM LTAAHALAVD AKNLLDVIDQ ARLKMLGQTR 

PH
Length:1,052
Mass (Da):119,233
Last modified:July 15, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD8A4C15138AB0243
GO
Isoform 2 (identifier: Q05397-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-181: Missing.
     182-189: EMRGNALE → MSDYWVVG
     472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE
     834-854: Missing.

Show »
Length:879
Mass (Da):99,358
Checksum:i64783EFF1FF4FCCB
GO
Isoform 3 (identifier: Q05397-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-181: Missing.
     182-189: EMRGNALE → MSDYWVVG
     472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE
     677-706: STILEEEKAQQEERMRMESRRQATVSWDSG → FQNPAQMLPASGRLPNQPCPERENYSFATF
     707-1052: Missing.

Show »
Length:554
Mass (Da):63,201
Checksum:i3960D6100B580E7D
GO
Isoform 4 (identifier: Q05397-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-181: Missing.
     182-189: EMRGNALE → MSDYWVVG
     472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE
     579-583: ASKGK → GKKSG
     584-1052: Missing.

Show »
Length:431
Mass (Da):48,967
Checksum:i9C8013A49B83C690
GO
Isoform 5 (identifier: Q05397-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-868: D → GKEEKNWAERN
     903-903: K → KPWR

Show »
Length:1,065
Mass (Da):120,900
Checksum:i3FC0C66C4CF858D8
GO
Isoform 6 (identifier: Q05397-6) [UniParc]FASTAAdd to basket
Also known as: FRNK

The sequence of this isoform differs from the canonical sequence as follows:
     1-692: Missing.

Note: Produced by alternative promoter usage.Curated
Show »
Length:360
Mass (Da):39,874
Checksum:i0BD7ACE4EAEE63C0
GO
Isoform 7 (identifier: Q05397-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     744-789: Missing.

Show »
Length:1,006
Mass (Da):114,253
Checksum:i5A98BE87F7C172F6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 32 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ESA6E7ESA6_HUMAN
Non-specific protein-tyrosine kinas...
PTK2
1,096Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBP1H0YBP1_HUMAN
Non-specific protein-tyrosine kinas...
PTK2
1,017Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB16H0YB16_HUMAN
Focal adhesion kinase 1
PTK2
724Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB99H0YB99_HUMAN
Non-specific protein-tyrosine kinas...
PTK2
319Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBZ1H0YBZ1_HUMAN
Focal adhesion kinase 1
PTK2
753Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PEI4E9PEI4_HUMAN
Focal adhesion kinase 1
PTK2
680Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DWJ1B4DWJ1_HUMAN
Focal adhesion kinase 1
PTK2
362Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGA6E5RGA6_HUMAN
Focal adhesion kinase 1
PTK2
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJP0E5RJP0_HUMAN
Focal adhesion kinase 1
PTK2
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFW9E5RFW9_HUMAN
Focal adhesion kinase 1
PTK2
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti184R → L in BAG65198 (PubMed:14702039).Curated1
Sequence conflicti211L → I in BAG65198 (PubMed:14702039).Curated1
Sequence conflicti778P → S in AAA35819 (PubMed:8422239).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_041682292H → P1 Publication1
Natural variantiVAR_041683292H → Q1 Publication1
Natural variantiVAR_041684793V → A in a glioblastoma multiforme sample; somatic mutation. 1 Publication1
Natural variantiVAR_0416851030D → E1 Publication1
Natural variantiVAR_0416861044K → E in a metastatic melanoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0421681 – 692Missing in isoform 6. CuratedAdd BLAST692
Alternative sequenceiVSP_0049671 – 181Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST181
Alternative sequenceiVSP_004968182 – 189EMRGNALE → MSDYWVVG in isoform 2, isoform 3 and isoform 4. 1 Publication8
Alternative sequenceiVSP_004969472A → ACHYTSLHWNWCRYISDPNV DACPDPRNAE in isoform 2, isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_004971579 – 583ASKGK → GKKSG in isoform 4. 1 Publication5
Alternative sequenceiVSP_004972584 – 1052Missing in isoform 4. 1 PublicationAdd BLAST469
Alternative sequenceiVSP_004973677 – 706STILE…SWDSG → FQNPAQMLPASGRLPNQPCP ERENYSFATF in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_004974707 – 1052Missing in isoform 3. 1 PublicationAdd BLAST346
Alternative sequenceiVSP_057268744 – 789Missing in isoform 7. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_004970834 – 854Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_042169868D → GKEEKNWAERN in isoform 5. 1 Publication1
Alternative sequenceiVSP_042170903K → KPWR in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L13616 mRNA Translation: AAA58469.1
L05186 mRNA Translation: AAA35819.1
AK304356 mRNA Translation: BAG65198.1
AC067931 Genomic DNA No translation available.
AC100860 Genomic DNA No translation available.
AC105009 Genomic DNA No translation available.
AC105235 Genomic DNA No translation available.
KF458878 Genomic DNA No translation available.
KF458882 Genomic DNA No translation available.
BC035404 mRNA Translation: AAH35404.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS56557.1 [Q05397-5]
CCDS6381.1 [Q05397-1]

Protein sequence database of the Protein Information Resource

More...PIRi		I53012
PC1225

NCBI Reference Sequences

More...RefSeqi		NP_001186578.1, NM_001199649.1 [Q05397-5]
NP_722560.1, NM_153831.3 [Q05397-1]
XP_016869162.1, XM_017013673.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000340930; ENSP00000341189; ENSG00000169398 [Q05397-5]
ENST00000395218; ENSP00000378644; ENSG00000169398 [Q05397-7]
ENST00000521059; ENSP00000429474; ENSG00000169398 [Q05397-1]
ENST00000522684; ENSP00000429911; ENSG00000169398 [Q05397-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5747

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5747

UCSC genome browser

More...UCSCi		uc003yvu.4, human [Q05397-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L13616 mRNA Translation: AAA58469.1
L05186 mRNA Translation: AAA35819.1
AK304356 mRNA Translation: BAG65198.1
AC067931 Genomic DNA No translation available.
AC100860 Genomic DNA No translation available.
AC105009 Genomic DNA No translation available.
AC105235 Genomic DNA No translation available.
KF458878 Genomic DNA No translation available.
KF458882 Genomic DNA No translation available.
BC035404 mRNA Translation: AAH35404.1
CCDSiCCDS56557.1 [Q05397-5]
CCDS6381.1 [Q05397-1]
PIRiI53012
PC1225
RefSeqiNP_001186578.1, NM_001199649.1 [Q05397-5]
NP_722560.1, NM_153831.3 [Q05397-1]
XP_016869162.1, XM_017013673.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K04X-ray1.95A891-1052[»]
1K05X-ray2.90A/B/C891-1052[»]
1MP8X-ray1.60A411-686[»]
1OW6X-ray2.35A/B/C892-1052[»]
1OW7X-ray2.60A/B/C892-1052[»]
1OW8X-ray2.85A/B/C892-1052[»]
2ETMX-ray2.30A/B411-689[»]
2IJMX-ray2.19A/B411-689[»]
3B71X-ray2.82A/B/C891-1052[»]
3BZ3X-ray2.20A414-689[»]
3PXKX-ray1.79A/B411-689[»]
3S9OX-ray2.60A/B/C891-1052[»]
4EBVX-ray1.67A411-686[»]
4EBWX-ray2.65A411-686[»]
4GU6X-ray1.95A/B411-689[»]
4GU9X-ray2.40A/B410-686[»]
4I4EX-ray1.55A411-686[»]
4I4FX-ray1.75A411-686[»]
4K8AX-ray2.91A/B410-686[»]
4K9YX-ray2.00A410-686[»]
4KABX-ray2.71A/B410-686[»]
4KAOX-ray2.39A/B410-689[»]
4NY0X-ray2.80A/B/C/D31-405[»]
4Q9SX-ray2.07A411-686[»]
6I8ZX-ray1.99A411-689[»]
6LESX-ray2.00A/B/X/Y805-832[»]
6PW8X-ray1.95A922-1047[»]
SMRiQ05397
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111719, 146 interactors
CORUMiQ05397
ELMiQ05397
IntActiQ05397, 88 interactors
MINTiQ05397
STRINGi9606.ENSP00000341189

Chemistry databases

BindingDBiQ05397
ChEMBLiCHEMBL2695
DrugBankiDB07460, 2-({5-CHLORO-2-[(2-METHOXY-4-MORPHOLIN-4-YLPHENYL)AMINO]PYRIMIDIN-4-YL}AMINO)-N-METHYLBENZAMIDE
DB07248, 7-PYRIDIN-2-YL-N-(3,4,5-TRIMETHOXYPHENYL)-7H-PYRROLO[2,3-D]PYRIMIDIN-2-AMINE
DB06423, Endostatin
DB12010, Fostamatinib
DrugCentraliQ05397
GuidetoPHARMACOLOGYi2180

PTM databases

CarbonylDBiQ05397
iPTMnetiQ05397
PhosphoSitePlusiQ05397

Genetic variation databases

BioMutaiPTK2
DMDMi3183518

Proteomic databases

CPTACiCPTAC-1785
EPDiQ05397
jPOSTiQ05397
MassIVEiQ05397
MaxQBiQ05397
PaxDbiQ05397
PeptideAtlasiQ05397
PRIDEiQ05397
ProteomicsDBi58320 [Q05397-1]
58321 [Q05397-2]
58322 [Q05397-3]
58323 [Q05397-4]
58324 [Q05397-5]
58325 [Q05397-6]
71210

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		725, 2764 antibodies

The DNASU plasmid repository

More...DNASUi		5747

Genome annotation databases

EnsembliENST00000340930; ENSP00000341189; ENSG00000169398 [Q05397-5]
ENST00000395218; ENSP00000378644; ENSG00000169398 [Q05397-7]
ENST00000521059; ENSP00000429474; ENSG00000169398 [Q05397-1]
ENST00000522684; ENSP00000429911; ENSG00000169398 [Q05397-1]
GeneIDi5747
KEGGihsa:5747
UCSCiuc003yvu.4, human [Q05397-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5747
DisGeNETi5747

GeneCards: human genes, protein and diseases

More...GeneCardsi		PTK2
HGNCiHGNC:9611, PTK2
HPAiENSG00000169398, Low tissue specificity
MIMi600758, gene
neXtProtiNX_Q05397
OpenTargetsiENSG00000169398
PharmGKBiPA33955
VEuPathDBiHostDB:ENSG00000169398.19

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4257, Eukaryota
GeneTreeiENSGT00940000155113
HOGENOMiCLU_002646_0_0_1
InParanoidiQ05397
OrthoDBi43729at2759
PhylomeDBiQ05397
TreeFamiTF316643

Enzyme and pathway databases

BRENDAi2.7.10.2, 2681
PathwayCommonsiQ05397
ReactomeiR-HSA-111465, Apoptotic cleavage of cellular proteins
R-HSA-2029482, Regulation of actin dynamics for phagocytic cup formation
R-HSA-354192, Integrin signaling
R-HSA-354194, GRB2:SOS provides linkage to MAPK signaling for Integrins
R-HSA-372708, p130Cas linkage to MAPK signaling for integrins
R-HSA-375165, NCAM signaling for neurite out-growth
R-HSA-391160, Signal regulatory protein family interactions
R-HSA-3928662, EPHB-mediated forward signaling
R-HSA-418885, DCC mediated attractive signaling
R-HSA-4420097, VEGFA-VEGFR2 Pathway
R-HSA-5663213, RHO GTPases Activate WASPs and WAVEs
R-HSA-5673001, RAF/MAP kinase cascade
R-HSA-8874081, MET activates PTK2 signaling
R-HSA-9009391, Extra-nuclear estrogen signaling
R-HSA-9634638, Estrogen-dependent nuclear events downstream of ESR-membrane signaling
R-HSA-9664422, FCGR3A-mediated phagocytosis
SignaLinkiQ05397
SIGNORiQ05397

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5747, 378 hits in 915 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PTK2, human
EvolutionaryTraceiQ05397

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PTK2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5747
PharosiQ05397, Tchem

Protein Ontology

More...PROi		PR:Q05397
RNActiQ05397, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000169398, Expressed in corpus callosum and 241 other tissues
ExpressionAtlasiQ05397, baseline and differential
GenevisibleiQ05397, HS

Family and domain databases

CDDicd14473, FERM_B-lobe, 1 hit
cd13190, FERM_C_FAK1, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749, Band_41_domain
IPR041390, FADK_N
IPR041784, FAK1/PYK2_FERM_C
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR000299, FERM_domain
IPR036137, Focal_adhe_kin_target_dom_sf
IPR005189, Focal_adhesion_kin_target_dom
IPR011009, Kinase-like_dom_sf
IPR011993, PH-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008266, Tyr_kinase_AS
IPR020635, Tyr_kinase_cat_dom
IPR029071, Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00373, FERM_M, 1 hit
PF18038, FERM_N_2, 1 hit
PF03623, Focal_AT, 1 hit
PF07714, PK_Tyr_Ser-Thr, 1 hit
PRINTSiPR00109, TYRKINASE
SMARTiView protein in SMART
SM00295, B41, 1 hit
SM00219, TyrKc, 1 hit
SUPFAMiSSF47031, SSF47031, 1 hit
SSF54236, SSF54236, 1 hit
SSF56112, SSF56112, 1 hit
SSF68993, SSF68993, 1 hit
PROSITEiView protein in PROSITE
PS00661, FERM_2, 1 hit
PS50057, FERM_3, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00109, PROTEIN_KINASE_TYR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFAK1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q05397
Secondary accession number(s): B4E2N6
, F5H4S4, J3QT16, Q14291, Q8IYN9, Q9UD85
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 15, 1998
Last modified: February 10, 2021
This is version 243 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with genetic variants
    List of human entries with genetic variants
  2. Human variants curated from literature reports
    Index of human variants curated from literature reports
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  7. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again