Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transducin-like enhancer protein 4

Gene

TLE4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Essential for the transcriptional repressor activity of SIX3 during retina and lens development and for SIX3 transcriptional auto-repression (By similarity).By similarity

Caution

It is uncertain whether Met-1 or Met-8 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4641265 Repression of WNT target genes

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q04727

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q04727

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transducin-like enhancer protein 4
Alternative name(s):
Grg-4
Groucho-related protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TLE4
Synonyms:GRG4, KIAA1261
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000106829.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11840 TLE4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605132 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q04727

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7091

Open Targets

More...
OpenTargetsi
ENSG00000106829

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36542

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158518541

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000512831 – 773Transducin-like enhancer protein 4Add BLAST773

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei208PhosphoserineCombined sources1
Modified residuei212PhosphoserineBy similarity1
Modified residuei222PhosphoserineBy similarity1
Modified residuei237N6-acetyllysineCombined sources1
Modified residuei245PhosphoserineBy similarity1
Modified residuei250PhosphoserineCombined sources1
Modified residuei269PhosphoserineCombined sources1
Modified residuei273PhosphoserineBy similarity1
Modified residuei281N6-acetyllysineCombined sources1
Modified residuei292PhosphoserineCombined sources1
Modified residuei318PhosphothreonineBy similarity1
Modified residuei321PhosphoserineBy similarity1
Modified residuei323PhosphoserineBy similarity1
Modified residuei325PhosphothreonineBy similarity1
Modified residuei327PhosphothreonineBy similarity1
Modified residuei334PhosphothreonineBy similarity1
Modified residuei340PhosphothreonineBy similarity1
Modified residuei419PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. PAX5 binding increases phosphorylation (By similarity).By similarity
Ubiquitinated by XIAP/BIRC4.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q04727

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q04727

PeptideAtlas

More...
PeptideAtlasi
Q04727

PRoteomics IDEntifications database

More...
PRIDEi
Q04727

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58272
58273 [Q04727-2]
58274 [Q04727-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q04727

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q04727

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In all tissues examined, mostly in brain, and muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000106829 Expressed in 194 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q04727 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q04727 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA065357

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer and heterooligomer with other family members. Binds PAX5, LEF1, TCF7, TCF7L1 and TCF7L2. Interacts with ZNF703; TLE4 may mediate ZNF703 transcriptional repression. Interacts with SIX3 and SIX6 (By similarity). Interacts with PAX2.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112946, 36 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q04727

Protein interaction database and analysis system

More...
IntActi
Q04727, 5 interactors

Molecular INTeraction database

More...
MINTi
Q04727

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000365735

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q04727

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q04727

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati485 – 523WD 1Add BLAST39
Repeati531 – 570WD 2Add BLAST40
Repeati575 – 614WD 3Add BLAST40
Repeati617 – 656WD 4Add BLAST40
Repeati658 – 697WD 5Add BLAST40
Repeati699 – 738WD 6Add BLAST40
Repeati740 – 773WD 7Add BLAST34

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 136Q domain1 PublicationAdd BLAST136
Regioni137 – 204GP domain1 PublicationAdd BLAST68
Regioni205 – 274CcN domain1 PublicationAdd BLAST70
Regioni275 – 452SP domain1 PublicationAdd BLAST178

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat Groucho/TLE family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0639 Eukaryota
ENOG410XPX3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153604

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004689

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q04727

Identification of Orthologs from Complete Genome Data

More...
OMAi
HHMRVPG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G181Y

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q04727

TreeFam database of animal gene trees

More...
TreeFami
TF314167

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10814 PTHR10814, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01850 GROUCHOFAMLY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q04727-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIRDLSKMYP QTRHPAPHQP AQPFKFTISE SCDRIKEEFQ FLQAQYHSLK
60 70 80 90 100
LECEKLASEK TEMQRHYVMY YEMSYGLNIE MHKQAEIVKR LNAICAQVIP
110 120 130 140 150
FLSQEHQQQV VQAVERAKQV TMAELNAIIG QQLQAQHLSH GHGLPVPLTP
160 170 180 190 200
HPSGLQPPAI PPIGSSAGLL ALSSALGGQS HLPIKDEKKH HDNDHQRDRD
210 220 230 240 250
SIKSSSVSPS ASFRGAEKHR NSADYSSESK KQKTEEKEIA ARYDSDGEKS
260 270 280 290 300
DDNLVVDVSN EDPSSPRGSP AHSPRENGLD KTRLLKKDAP ISPASIASSS
310 320 330 340 350
STPSSKSKEL SLNEKSTTPV SKSNTPTPRT DAPTPGSNST PGLRPVPGKP
360 370 380 390 400
PGVDPLASSL RTPMAVPCPY PTPFGIVPHA GMNGELTSPG AAYAGLHNIS
410 420 430 440 450
PQMSAAAAAA AAAAAYGRSP VVGFDPHHHM RVPAIPPNLT GIPGGKPAYS
460 470 480 490 500
FHVSADGQMQ PVPFPPDALI GPGIPRHARQ INTLNHGEVV CAVTISNPTR
510 520 530 540 550
HVYTGGKGCV KVWDISHPGN KSPVSQLDCL NRDNYIRSCR LLPDGRTLIV
560 570 580 590 600
GGEASTLSIW DLAAPTPRIK AELTSSAPAC YALAISPDSK VCFSCCSDGN
610 620 630 640 650
IAVWDLHNQT LVRQFQGHTD GASCIDISND GTKLWTGGLD NTVRSWDLRE
660 670 680 690 700
GRQLQQHDFT SQIFSLGYCP TGEWLAVGME NSNVEVLHVT KPDKYQLHLH
710 720 730 740 750
ESCVLSLKFA HCGKWFVSTG KDNLLNAWRT PYGASIFQSK ESSSVLSCDI
760 770
SVDDKYIVTG SGDKKATVYE VIY
Length:773
Mass (Da):83,755
Last modified:September 11, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDA138F1DA29E81B6
GO
Isoform 2 (identifier: Q04727-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-312: Missing.

Note: No experimental confirmation available.
Show »
Length:704
Mass (Da):76,581
Checksum:iEF8F211B53D9CD3C
GO
Isoform 3 (identifier: Q04727-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-312: L → LKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFM

Note: No experimental confirmation available.
Show »
Length:805
Mass (Da):87,702
Checksum:i7301C1C49E992219
GO
Isoform 4 (identifier: Q04727-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-130: Missing.

Show »
Length:748
Mass (Da):81,011
Checksum:i2402704F8D17A77E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JSY7Q5JSY7_HUMAN
Transducin-like enhancer protein 4
TLE4
322Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JSY8Q5JSY8_HUMAN
Transducin-like enhancer protein 4
TLE4
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JSZ2Q5JSZ2_HUMAN
Transducin-like enhancer protein 4
TLE4
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JSZ1Q5JSZ1_HUMAN
Transducin-like enhancer protein 4
TLE4
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQH3E7EQH3_HUMAN
Transducin-like enhancer protein 4
TLE4
259Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4P7H7C4P7_HUMAN
Transducin-like enhancer protein 4
TLE4
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAY5F8WAY5_HUMAN
Transducin-like enhancer protein 4
TLE4
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT79A0A0A0MT79_HUMAN
Transducin-like enhancer of split 4...
TLE4 hCG_1984553
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4E4H7C4E4_HUMAN
Transducin-like enhancer protein 4
TLE4
343Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4W5H7C4W5_HUMAN
Transducin-like enhancer protein 4
TLE4
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86575 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti131Q → QQ in CAB82397 (PubMed:17974005).Curated1
Sequence conflicti468A → P in AAA61195 (PubMed:1303260).Curated1
Sequence conflicti509C → A in AAA61195 (PubMed:1303260).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055169106 – 130Missing in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_030497244 – 312Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_030498312L → LKRDMGKLSETRLSEDEQCT LGLQRWFCRLWFM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB033087 mRNA Translation: BAA86575.1 Different initiation.
AK296342 mRNA Translation: BAG59027.1
AL353813 Genomic DNA No translation available.
AL358975 Genomic DNA No translation available.
AL445252 Genomic DNA No translation available.
BC045650 mRNA Translation: AAH45650.1
BC059405 mRNA Translation: AAH59405.2
AL162059 mRNA Translation: CAB82397.1
M99439 mRNA Translation: AAA61195.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43837.1 [Q04727-1]
CCDS65069.1 [Q04727-3]
CCDS65070.1 [Q04727-4]
CCDS75851.1 [Q04727-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T47149

NCBI Reference Sequences

More...
RefSeqi
NP_001269677.1, NM_001282748.1 [Q04727-3]
NP_001269678.1, NM_001282749.1 [Q04727-4]
NP_001269682.1, NM_001282753.1 [Q04727-2]
NP_008936.2, NM_007005.4 [Q04727-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.444213

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265284; ENSP00000265284; ENSG00000106829 [Q04727-4]
ENST00000376537; ENSP00000365720; ENSG00000106829 [Q04727-3]
ENST00000376544; ENSP00000365727; ENSG00000106829 [Q04727-2]
ENST00000376552; ENSP00000365735; ENSG00000106829 [Q04727-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7091

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7091

UCSC genome browser

More...
UCSCi
uc004alc.5 human [Q04727-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033087 mRNA Translation: BAA86575.1 Different initiation.
AK296342 mRNA Translation: BAG59027.1
AL353813 Genomic DNA No translation available.
AL358975 Genomic DNA No translation available.
AL445252 Genomic DNA No translation available.
BC045650 mRNA Translation: AAH45650.1
BC059405 mRNA Translation: AAH59405.2
AL162059 mRNA Translation: CAB82397.1
M99439 mRNA Translation: AAA61195.1
CCDSiCCDS43837.1 [Q04727-1]
CCDS65069.1 [Q04727-3]
CCDS65070.1 [Q04727-4]
CCDS75851.1 [Q04727-2]
PIRiT47149
RefSeqiNP_001269677.1, NM_001282748.1 [Q04727-3]
NP_001269678.1, NM_001282749.1 [Q04727-4]
NP_001269682.1, NM_001282753.1 [Q04727-2]
NP_008936.2, NM_007005.4 [Q04727-1]
UniGeneiHs.444213

3D structure databases

ProteinModelPortaliQ04727
SMRiQ04727
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112946, 36 interactors
CORUMiQ04727
IntActiQ04727, 5 interactors
MINTiQ04727
STRINGi9606.ENSP00000365735

PTM databases

iPTMnetiQ04727
PhosphoSitePlusiQ04727

Polymorphism and mutation databases

DMDMi158518541

Proteomic databases

MaxQBiQ04727
PaxDbiQ04727
PeptideAtlasiQ04727
PRIDEiQ04727
ProteomicsDBi58272
58273 [Q04727-2]
58274 [Q04727-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265284; ENSP00000265284; ENSG00000106829 [Q04727-4]
ENST00000376537; ENSP00000365720; ENSG00000106829 [Q04727-3]
ENST00000376544; ENSP00000365727; ENSG00000106829 [Q04727-2]
ENST00000376552; ENSP00000365735; ENSG00000106829 [Q04727-1]
GeneIDi7091
KEGGihsa:7091
UCSCiuc004alc.5 human [Q04727-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7091
DisGeNETi7091
EuPathDBiHostDB:ENSG00000106829.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TLE4
HGNCiHGNC:11840 TLE4
HPAiHPA065357
MIMi605132 gene
neXtProtiNX_Q04727
OpenTargetsiENSG00000106829
PharmGKBiPA36542

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0639 Eukaryota
ENOG410XPX3 LUCA
GeneTreeiENSGT00940000153604
HOVERGENiHBG004689
InParanoidiQ04727
OMAiHHMRVPG
OrthoDBiEOG091G181Y
PhylomeDBiQ04727
TreeFamiTF314167

Enzyme and pathway databases

ReactomeiR-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4641265 Repression of WNT target genes
SignaLinkiQ04727
SIGNORiQ04727

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TLE4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7091

Protein Ontology

More...
PROi
PR:Q04727

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000106829 Expressed in 194 organ(s), highest expression level in testis
ExpressionAtlasiQ04727 baseline and differential
GenevisibleiQ04727 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10814 PTHR10814, 1 hit
PfamiView protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 2 hits
PRINTSiPR01850 GROUCHOFAMLY
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTLE4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q04727
Secondary accession number(s): F8W6T6
, Q3ZCS1, Q5T1Y2, Q6PCB3, Q9BZ07, Q9BZ08, Q9BZ09, Q9NSL3, Q9ULF9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: September 11, 2007
Last modified: December 5, 2018
This is version 192 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again