Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transducin-like enhancer protein 2

Gene

TLE2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • repressing transcription factor binding Source: GO_Central
  • transcription corepressor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4641265 Repression of WNT target genes

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q04725

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q04725

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transducin-like enhancer protein 2
Alternative name(s):
Enhancer of split groucho-like protein 2
Short name:
ESG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TLE2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000065717.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11838 TLE2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601041 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q04725

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7089

Open Targets

More...
OpenTargetsi
ENSG00000065717

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36540

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TLE2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20532416

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000512781 – 743Transducin-like enhancer protein 2Add BLAST743

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei228Phosphoserine; by CK2Sequence analysis1
Modified residuei249Phosphoserine; by CDK1Sequence analysis1
Modified residuei253Phosphothreonine; by CDK1Sequence analysis1
Modified residuei281PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by XIAP/BIRC4.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q04725

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q04725

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q04725

PeptideAtlas

More...
PeptideAtlasi
Q04725

PRoteomics IDEntifications database

More...
PRIDEi
Q04725

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58267

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q04725

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q04725

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In all tissues examined, mostly in heart, brain, and muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000065717 Expressed in 232 organ(s), highest expression level in right hemisphere of cerebellum

CleanEx database of gene expression profiles

More...
CleanExi
HS_TLE2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q04725 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q04725 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA049103

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer and heterooligomer with other family members. Binds LEF1, TCF7, TCF7L1, TCF7L2, UTY, HES1 and HES5.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
DDB1Q165312EBI-1176061,EBI-350322

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112944, 31 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q04725

Protein interaction database and analysis system

More...
IntActi
Q04725, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262953

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q04725

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q04725

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati455 – 493WD 1Add BLAST39
Repeati501 – 540WD 2Add BLAST40
Repeati545 – 584WD 3Add BLAST40
Repeati587 – 626WD 4Add BLAST40
Repeati669 – 708WD 5Add BLAST40
Repeati710 – 742WD 6Add BLAST33

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 127Q domainBy similarityAdd BLAST127
Regioni128 – 191GP domainBy similarityAdd BLAST64
Regioni192 – 254CcN domainBy similarityAdd BLAST63
Regioni255 – 423SP domainBy similarityAdd BLAST169

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi214 – 217Nuclear localization signalSequence analysis4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat Groucho/TLE family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0639 Eukaryota
ENOG410XPX3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154193

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293211

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004689

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q04725

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q04725

TreeFam database of animal gene trees

More...
TreeFami
TF314167

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10814 PTHR10814, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01850 GROUCHOFAMLY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q04725-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYPQGRHPTP LQSGQPFKFS ILEICDRIKE EFQFLQAQYH SLKLECEKLA
60 70 80 90 100
SEKTEMQRHY VMYYEMSYGL NIEMHKQAEI VKRLSGICAQ IIPFLTQEHQ
110 120 130 140 150
QQVLQAVERA KQVTVGELNS LIGQQLQPLS HHAPPVPLTP RPAGLVGGSA
160 170 180 190 200
TGLLALSGAL AAQAQLAAAV KEDRAGVEAE GSRVERAPSR SASPSPPESL
210 220 230 240 250
VEEERPSGPG GGGKQRADEK EPSGPYESDE DKSDYNLVVD EDQPSEPPSP
260 270 280 290 300
ATTPCGKVPI CIPARRDLVD SPASLASSLG SPLPRAKELI LNDLPASTPA
310 320 330 340 350
SKSCDSSPPQ DASTPGPSSA SHLCQLAAKP APSTDSVALR SPLTLSSPFT
360 370 380 390 400
TSFSLGSHST LNGDLSVPSS YVSLHLSPQV SSSVVYGRSP VMAFESHPHL
410 420 430 440 450
RGSSVSSSLP SIPGGKPAYS FHVSADGQMQ PVPFPSDALV GAGIPRHARQ
460 470 480 490 500
LHTLAHGEVV CAVTISGSTQ HVYTGGKGCV KVWDVGQPGA KTPVAQLDCL
510 520 530 540 550
NRDNYIRSCK LLPDGRSLIV GGEASTLSIW DLAAPTPRIK AELTSSAPAC
560 570 580 590 600
YALAVSPDAK VCFSCCSDGN IVVWDLQNQT MVRQFQGHTD GASCIDISDY
610 620 630 640 650
GTRLWTGGLD NTVRCWDLRE GRQLQQHDFS SQIFSLGHCP NQDWLAVGME
660 670 680 690 700
SSNVEILHVR KPEKYQLHLH ESCVLSLKFA SCGRWFVSTG KDNLLNAWRT
710 720 730 740
PYGASIFQSK ESSSVLSCDI SRNNKYIVTG SGDKKATVYE VVY
Length:743
Mass (Da):79,841
Last modified:May 10, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5E3DBFAB67278219
GO
Isoform 2 (identifier: Q04725-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.
     124-190: Missing.

Note: No experimental confirmation available.
Show »
Length:621
Mass (Da):66,678
Checksum:iF5100FF0B0FECFBA
GO
Isoform 3 (identifier: Q04725-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MYPQGRHP → MVQSRLTATSASQDSPASGLQ
     124-124: Q → QQ
     683-743: GRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY → VQGVVLSPEL

Note: No experimental confirmation available.
Show »
Length:706
Mass (Da):75,364
Checksum:i71A2BA068112A6AE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EMK7K7EMK7_HUMAN
Transducin-like enhancer protein 2
TLE2
744Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJR7K7EJR7_HUMAN
Transducin-like enhancer protein 2
TLE2
280Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPF3K7EPF3_HUMAN
Transducin-like enhancer protein 2
TLE2
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPD4K7EPD4_HUMAN
Transducin-like enhancer protein 2
TLE2
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESD8K7ESD8_HUMAN
Transducin-like enhancer protein 2
TLE2
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EK93K7EK93_HUMAN
Transducin-like enhancer protein 2
TLE2
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AK308137 differs from that shown. Reason: Frameshift at position 537.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti280G → R in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti328A → L in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti441G → D in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti495A → R in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti636 – 637LG → PC in AAA61193 (PubMed:1303260).Curated2
Sequence conflicti660R → G in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti681S → P in AAA61193 (PubMed:1303260).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_069063381S → G1 PublicationCorresponds to variant dbSNP:rs199788562Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456931 – 55Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0461621 – 8MYPQGRHP → MVQSRLTATSASQDSPASGL Q in isoform 3. 1 Publication8
Alternative sequenceiVSP_045694124 – 190Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_046163124Q → QQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_046164683 – 743GRWFV…YEVVY → VQGVVLSPEL in isoform 3. 1 PublicationAdd BLAST61

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M99436 mRNA Translation: AAA61193.1
AK293407 mRNA Translation: BAG56914.1
AK308137 mRNA No translation available.
AC007766 Genomic DNA Translation: AAD38075.1
AC011549 Genomic DNA No translation available.
AC093053 Genomic DNA No translation available.
BC017364 mRNA Translation: AAH17364.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45911.1 [Q04725-1]
CCDS45912.1 [Q04725-2]
CCDS45913.1 [Q04725-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
C56695

NCBI Reference Sequences

More...
RefSeqi
NP_001138233.1, NM_001144761.1 [Q04725-3]
NP_001138234.1, NM_001144762.1 [Q04725-2]
NP_001287775.1, NM_001300846.1
NP_003251.2, NM_003260.4 [Q04725-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.332173

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262953; ENSP00000262953; ENSG00000065717 [Q04725-1]
ENST00000426948; ENSP00000392869; ENSG00000065717 [Q04725-3]
ENST00000443826; ENSP00000392427; ENSG00000065717 [Q04725-2]
ENST00000455444; ENSP00000413107; ENSG00000065717 [Q04725-2]
ENST00000591529; ENSP00000468279; ENSG00000065717 [Q04725-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7089

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7089

UCSC genome browser

More...
UCSCi
uc002lww.3 human [Q04725-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M99436 mRNA Translation: AAA61193.1
AK293407 mRNA Translation: BAG56914.1
AK308137 mRNA No translation available.
AC007766 Genomic DNA Translation: AAD38075.1
AC011549 Genomic DNA No translation available.
AC093053 Genomic DNA No translation available.
BC017364 mRNA Translation: AAH17364.1
CCDSiCCDS45911.1 [Q04725-1]
CCDS45912.1 [Q04725-2]
CCDS45913.1 [Q04725-3]
PIRiC56695
RefSeqiNP_001138233.1, NM_001144761.1 [Q04725-3]
NP_001138234.1, NM_001144762.1 [Q04725-2]
NP_001287775.1, NM_001300846.1
NP_003251.2, NM_003260.4 [Q04725-1]
UniGeneiHs.332173

3D structure databases

ProteinModelPortaliQ04725
SMRiQ04725
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112944, 31 interactors
CORUMiQ04725
IntActiQ04725, 3 interactors
STRINGi9606.ENSP00000262953

PTM databases

iPTMnetiQ04725
PhosphoSitePlusiQ04725

Polymorphism and mutation databases

BioMutaiTLE2
DMDMi20532416

Proteomic databases

EPDiQ04725
MaxQBiQ04725
PaxDbiQ04725
PeptideAtlasiQ04725
PRIDEiQ04725
ProteomicsDBi58267

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7089
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262953; ENSP00000262953; ENSG00000065717 [Q04725-1]
ENST00000426948; ENSP00000392869; ENSG00000065717 [Q04725-3]
ENST00000443826; ENSP00000392427; ENSG00000065717 [Q04725-2]
ENST00000455444; ENSP00000413107; ENSG00000065717 [Q04725-2]
ENST00000591529; ENSP00000468279; ENSG00000065717 [Q04725-3]
GeneIDi7089
KEGGihsa:7089
UCSCiuc002lww.3 human [Q04725-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7089
DisGeNETi7089
EuPathDBiHostDB:ENSG00000065717.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TLE2
HGNCiHGNC:11838 TLE2
HPAiHPA049103
MIMi601041 gene
neXtProtiNX_Q04725
OpenTargetsiENSG00000065717
PharmGKBiPA36540

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0639 Eukaryota
ENOG410XPX3 LUCA
GeneTreeiENSGT00940000154193
HOGENOMiHOG000293211
HOVERGENiHBG004689
InParanoidiQ04725
PhylomeDBiQ04725
TreeFamiTF314167

Enzyme and pathway databases

ReactomeiR-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4641265 Repression of WNT target genes
SignaLinkiQ04725
SIGNORiQ04725

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TLE2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TLE2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7089

Protein Ontology

More...
PROi
PR:Q04725

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000065717 Expressed in 232 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_TLE2
ExpressionAtlasiQ04725 baseline and differential
GenevisibleiQ04725 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10814 PTHR10814, 1 hit
PfamiView protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 3 hits
PRINTSiPR01850 GROUCHOFAMLY
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTLE2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q04725
Secondary accession number(s): B4DE03
, E9PEV7, F8WCH2, Q8WVY0, Q9Y6S0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: May 10, 2002
Last modified: December 5, 2018
This is version 174 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again