Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transducin-like enhancer protein 2

Gene

TLE2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (By similarity).By similarity

GO - Molecular functioni

  • transcription corepressor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4641265 Repression of WNT target genes
SignaLinkiQ04725
SIGNORiQ04725

Names & Taxonomyi

Protein namesi
Recommended name:
Transducin-like enhancer protein 2
Alternative name(s):
Enhancer of split groucho-like protein 2
Short name:
ESG2
Gene namesi
Name:TLE2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000065717.14
HGNCiHGNC:11838 TLE2
MIMi601041 gene
neXtProtiNX_Q04725

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7089
OpenTargetsiENSG00000065717
PharmGKBiPA36540

Polymorphism and mutation databases

BioMutaiTLE2
DMDMi20532416

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000512781 – 743Transducin-like enhancer protein 2Add BLAST743

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei228Phosphoserine; by CK2Sequence analysis1
Modified residuei249Phosphoserine; by CDK1Sequence analysis1
Modified residuei253Phosphothreonine; by CDK1Sequence analysis1
Modified residuei281PhosphoserineCombined sources1

Post-translational modificationi

Ubiquitinated by XIAP/BIRC4.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ04725
MaxQBiQ04725
PaxDbiQ04725
PeptideAtlasiQ04725
PRIDEiQ04725
ProteomicsDBi58267

PTM databases

iPTMnetiQ04725
PhosphoSitePlusiQ04725

Expressioni

Tissue specificityi

In all tissues examined, mostly in heart, brain, and muscle.

Gene expression databases

BgeeiENSG00000065717 Expressed in 232 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_TLE2
ExpressionAtlasiQ04725 baseline and differential
GenevisibleiQ04725 HS

Organism-specific databases

HPAiHPA049103

Interactioni

Subunit structurei

Homooligomer and heterooligomer with other family members. Binds LEF1, TCF7, TCF7L1, TCF7L2, UTY, HES1 and HES5.

Binary interactionsi

WithEntry#Exp.IntActNotes
DDB1Q165312EBI-1176061,EBI-350322

Protein-protein interaction databases

BioGridi112944, 31 interactors
CORUMiQ04725
IntActiQ04725, 3 interactors
STRINGi9606.ENSP00000262953

Structurei

3D structure databases

ProteinModelPortaliQ04725
SMRiQ04725
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati455 – 493WD 1Add BLAST39
Repeati501 – 540WD 2Add BLAST40
Repeati545 – 584WD 3Add BLAST40
Repeati587 – 626WD 4Add BLAST40
Repeati669 – 708WD 5Add BLAST40
Repeati710 – 742WD 6Add BLAST33

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 127Q domainBy similarityAdd BLAST127
Regioni128 – 191GP domainBy similarityAdd BLAST64
Regioni192 – 254CcN domainBy similarityAdd BLAST63
Regioni255 – 423SP domainBy similarityAdd BLAST169

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi214 – 217Nuclear localization signalSequence analysis4

Domaini

WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.1 Publication

Sequence similaritiesi

Belongs to the WD repeat Groucho/TLE family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0639 Eukaryota
ENOG410XPX3 LUCA
GeneTreeiENSGT00550000074465
HOGENOMiHOG000293211
HOVERGENiHBG004689
InParanoidiQ04725
PhylomeDBiQ04725
TreeFamiTF314167

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 3 hits
PRINTSiPR01850 GROUCHOFAMLY
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q04725-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYPQGRHPTP LQSGQPFKFS ILEICDRIKE EFQFLQAQYH SLKLECEKLA
60 70 80 90 100
SEKTEMQRHY VMYYEMSYGL NIEMHKQAEI VKRLSGICAQ IIPFLTQEHQ
110 120 130 140 150
QQVLQAVERA KQVTVGELNS LIGQQLQPLS HHAPPVPLTP RPAGLVGGSA
160 170 180 190 200
TGLLALSGAL AAQAQLAAAV KEDRAGVEAE GSRVERAPSR SASPSPPESL
210 220 230 240 250
VEEERPSGPG GGGKQRADEK EPSGPYESDE DKSDYNLVVD EDQPSEPPSP
260 270 280 290 300
ATTPCGKVPI CIPARRDLVD SPASLASSLG SPLPRAKELI LNDLPASTPA
310 320 330 340 350
SKSCDSSPPQ DASTPGPSSA SHLCQLAAKP APSTDSVALR SPLTLSSPFT
360 370 380 390 400
TSFSLGSHST LNGDLSVPSS YVSLHLSPQV SSSVVYGRSP VMAFESHPHL
410 420 430 440 450
RGSSVSSSLP SIPGGKPAYS FHVSADGQMQ PVPFPSDALV GAGIPRHARQ
460 470 480 490 500
LHTLAHGEVV CAVTISGSTQ HVYTGGKGCV KVWDVGQPGA KTPVAQLDCL
510 520 530 540 550
NRDNYIRSCK LLPDGRSLIV GGEASTLSIW DLAAPTPRIK AELTSSAPAC
560 570 580 590 600
YALAVSPDAK VCFSCCSDGN IVVWDLQNQT MVRQFQGHTD GASCIDISDY
610 620 630 640 650
GTRLWTGGLD NTVRCWDLRE GRQLQQHDFS SQIFSLGHCP NQDWLAVGME
660 670 680 690 700
SSNVEILHVR KPEKYQLHLH ESCVLSLKFA SCGRWFVSTG KDNLLNAWRT
710 720 730 740
PYGASIFQSK ESSSVLSCDI SRNNKYIVTG SGDKKATVYE VVY
Length:743
Mass (Da):79,841
Last modified:May 10, 2002 - v2
Checksum:i5E3DBFAB67278219
GO
Isoform 2 (identifier: Q04725-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.
     124-190: Missing.

Note: No experimental confirmation available.
Show »
Length:621
Mass (Da):66,678
Checksum:iF5100FF0B0FECFBA
GO
Isoform 3 (identifier: Q04725-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MYPQGRHP → MVQSRLTATSASQDSPASGLQ
     124-124: Q → QQ
     683-743: GRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY → VQGVVLSPEL

Note: No experimental confirmation available.
Show »
Length:706
Mass (Da):75,364
Checksum:i71A2BA068112A6AE
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EMK7K7EMK7_HUMAN
Transducin-like enhancer protein 2
TLE2
744Annotation score:
K7EJR7K7EJR7_HUMAN
Transducin-like enhancer protein 2
TLE2
280Annotation score:
K7EPD4K7EPD4_HUMAN
Transducin-like enhancer protein 2
TLE2
131Annotation score:
K7ESD8K7ESD8_HUMAN
Transducin-like enhancer protein 2
TLE2
178Annotation score:
K7EPF3K7EPF3_HUMAN
Transducin-like enhancer protein 2
TLE2
140Annotation score:
K7EK93K7EK93_HUMAN
Transducin-like enhancer protein 2
TLE2
119Annotation score:

Sequence cautioni

The sequence AK308137 differs from that shown. Reason: Frameshift at position 537.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti280G → R in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti328A → L in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti441G → D in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti495A → R in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti636 – 637LG → PC in AAA61193 (PubMed:1303260).Curated2
Sequence conflicti660R → G in AAA61193 (PubMed:1303260).Curated1
Sequence conflicti681S → P in AAA61193 (PubMed:1303260).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069063381S → G1 PublicationCorresponds to variant dbSNP:rs199788562Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456931 – 55Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0461621 – 8MYPQGRHP → MVQSRLTATSASQDSPASGL Q in isoform 3. 1 Publication8
Alternative sequenceiVSP_045694124 – 190Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_046163124Q → QQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_046164683 – 743GRWFV…YEVVY → VQGVVLSPEL in isoform 3. 1 PublicationAdd BLAST61

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M99436 mRNA Translation: AAA61193.1
AK293407 mRNA Translation: BAG56914.1
AK308137 mRNA No translation available.
AC007766 Genomic DNA Translation: AAD38075.1
AC011549 Genomic DNA No translation available.
AC093053 Genomic DNA No translation available.
BC017364 mRNA Translation: AAH17364.1
CCDSiCCDS45911.1 [Q04725-1]
CCDS45912.1 [Q04725-2]
CCDS45913.1 [Q04725-3]
PIRiC56695
RefSeqiNP_001138233.1, NM_001144761.1 [Q04725-3]
NP_001138234.1, NM_001144762.1 [Q04725-2]
NP_001287775.1, NM_001300846.1
NP_003251.2, NM_003260.4 [Q04725-1]
UniGeneiHs.332173

Genome annotation databases

EnsembliENST00000262953; ENSP00000262953; ENSG00000065717 [Q04725-1]
ENST00000426948; ENSP00000392869; ENSG00000065717 [Q04725-3]
ENST00000443826; ENSP00000392427; ENSG00000065717 [Q04725-2]
ENST00000455444; ENSP00000413107; ENSG00000065717 [Q04725-2]
ENST00000591529; ENSP00000468279; ENSG00000065717 [Q04725-3]
GeneIDi7089
KEGGihsa:7089
UCSCiuc002lww.3 human [Q04725-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M99436 mRNA Translation: AAA61193.1
AK293407 mRNA Translation: BAG56914.1
AK308137 mRNA No translation available.
AC007766 Genomic DNA Translation: AAD38075.1
AC011549 Genomic DNA No translation available.
AC093053 Genomic DNA No translation available.
BC017364 mRNA Translation: AAH17364.1
CCDSiCCDS45911.1 [Q04725-1]
CCDS45912.1 [Q04725-2]
CCDS45913.1 [Q04725-3]
PIRiC56695
RefSeqiNP_001138233.1, NM_001144761.1 [Q04725-3]
NP_001138234.1, NM_001144762.1 [Q04725-2]
NP_001287775.1, NM_001300846.1
NP_003251.2, NM_003260.4 [Q04725-1]
UniGeneiHs.332173

3D structure databases

ProteinModelPortaliQ04725
SMRiQ04725
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112944, 31 interactors
CORUMiQ04725
IntActiQ04725, 3 interactors
STRINGi9606.ENSP00000262953

PTM databases

iPTMnetiQ04725
PhosphoSitePlusiQ04725

Polymorphism and mutation databases

BioMutaiTLE2
DMDMi20532416

Proteomic databases

EPDiQ04725
MaxQBiQ04725
PaxDbiQ04725
PeptideAtlasiQ04725
PRIDEiQ04725
ProteomicsDBi58267

Protocols and materials databases

DNASUi7089
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262953; ENSP00000262953; ENSG00000065717 [Q04725-1]
ENST00000426948; ENSP00000392869; ENSG00000065717 [Q04725-3]
ENST00000443826; ENSP00000392427; ENSG00000065717 [Q04725-2]
ENST00000455444; ENSP00000413107; ENSG00000065717 [Q04725-2]
ENST00000591529; ENSP00000468279; ENSG00000065717 [Q04725-3]
GeneIDi7089
KEGGihsa:7089
UCSCiuc002lww.3 human [Q04725-1]

Organism-specific databases

CTDi7089
DisGeNETi7089
EuPathDBiHostDB:ENSG00000065717.14
GeneCardsiTLE2
HGNCiHGNC:11838 TLE2
HPAiHPA049103
MIMi601041 gene
neXtProtiNX_Q04725
OpenTargetsiENSG00000065717
PharmGKBiPA36540
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0639 Eukaryota
ENOG410XPX3 LUCA
GeneTreeiENSGT00550000074465
HOGENOMiHOG000293211
HOVERGENiHBG004689
InParanoidiQ04725
PhylomeDBiQ04725
TreeFamiTF314167

Enzyme and pathway databases

ReactomeiR-HSA-201722 Formation of the beta-catenin:TCF transactivating complex
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-3769402 Deactivation of the beta-catenin transactivating complex
R-HSA-4641265 Repression of WNT target genes
SignaLinkiQ04725
SIGNORiQ04725

Miscellaneous databases

ChiTaRSiTLE2 human
GeneWikiiTLE2
GenomeRNAii7089
PROiPR:Q04725
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000065717 Expressed in 232 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_TLE2
ExpressionAtlasiQ04725 baseline and differential
GenevisibleiQ04725 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 3 hits
PRINTSiPR01850 GROUCHOFAMLY
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiTLE2_HUMAN
AccessioniPrimary (citable) accession number: Q04725
Secondary accession number(s): B4DE03
, E9PEV7, F8WCH2, Q8WVY0, Q9Y6S0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: May 10, 2002
Last modified: September 12, 2018
This is version 171 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again