Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 181 (22 Apr 2020)
Sequence version 3 (19 Sep 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-activated potassium channel slowpoke

Gene

slo

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Kinetics are determined by alternative splicing, phosphorylation status and its combination interaction with Slob and 14-3-3-zeta. While the interaction with Slob1 alone increases its activity, its interaction with both Slob1 and 14-3-3-zeta decreases its activity.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Potassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-1300642 Sperm Motility And Taxes

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.1.3.1 the voltage-gated ion channel (vic) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-activated potassium channel slowpoke
Short name:
dSlo
Alternative name(s):
BK channel
Maxi K channel
Short name:
MaxiK
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:slo
ORF Names:CG10693
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0003429 slo

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 48ExtracellularSequence analysisAdd BLAST48
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei49 – 69Helical; Name=Segment S0Sequence analysisAdd BLAST21
Topological domaini70 – 127CytoplasmicSequence analysisAdd BLAST58
Transmembranei128 – 149Helical; Name=Segment S1Sequence analysisAdd BLAST22
Topological domaini150 – 164ExtracellularSequence analysisAdd BLAST15
Transmembranei165 – 185Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini186 – 189CytoplasmicSequence analysis4
Transmembranei190 – 210Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini211 – 214ExtracellularSequence analysis4
Transmembranei215 – 235Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini236 – 250CytoplasmicSequence analysisAdd BLAST15
Transmembranei251 – 271Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini272 – 284ExtracellularSequence analysisAdd BLAST13
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei285 – 307Pore-forming; Name=P regionSequence analysisAdd BLAST23
Topological domaini308 – 316ExtracellularSequence analysis9
Transmembranei317 – 337Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini338 – 1200CytoplasmicSequence analysisAdd BLAST863

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi552Y → F: Affects the interaction with SRC. 1 Publication1
Mutagenesisi978S → A: Does not affect activation of channel. 1 Publication1
Mutagenesisi1002 – 1006DDDDD → NNNNN: Alters calcium binding. 1 Publication5
Mutagenesisi1012Y → F: Affects the interaction with SRC. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000541411 – 1200Calcium-activated potassium channel slowpokeAdd BLAST1200

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei978Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation may be mediated by both PKA and SRC kinases, which activate the channel activity. Phosphorylation by PKA is however unclear. Indeed, although modulation of channel activity requires Pka-C1, it does not interacts with the whole PKA holoenzyme. Moreover, modulation of activity does not depend upon phosphorylation of Ser-978.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q03720

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q03720

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in muscle cells, neurons of the CNS and PNS, mushroom bodies, a limited number of cells in embryonic and larval midgut and in epithelial-derived tracheal cells. During pupariation and embryogenesis, it is expressed in muscles many hours prior to the appearance of functional channels.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0003429 Expressed in head and 13 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q03720 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q03720 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer; which constitutes the calcium-activated potassium channel (By similarity).

Interacts with Slip1.

Interacts with Slob, and, indirectly with 14-3-3-zeta via its interaction with Slob.

Interacts with Pka-C1 and Src kinases, which can bind simultaneously to it.

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
67865, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q03720, 9 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0303318

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q03720

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini364 – 507RCK N-terminalAdd BLAST144

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni505 – 525Segment S7Add BLAST21
Regioni563 – 583Segment S8Add BLAST21
Regioni828 – 848Segment S9Add BLAST21
Regioni1017 – 1037Segment S10Add BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi301 – 304Selectivity for potassium4
Motifi988 – 1010Calcium bowlAdd BLAST23

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.By similarity
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium (By similarity).By similarity
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ (By similarity).By similarity
The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168407

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q03720

KEGG Orthology (KO)

More...
KOi
K04936

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q03720

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024939 Ca-act_K_channel_Slo-1
IPR005821 Ion_trans_dom
IPR003929 K_chnl_BK_asu
IPR036291 NAD(P)-bd_dom_sf
IPR027359 Volt_channel_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10027:SF28 PTHR10027:SF28, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03493 BK_channel_a, 1 hit
PF00520 Ion_trans, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735 SSF51735, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (20+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 20 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 20 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform N (identifier: Q03720-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASGLIDTNF SSTLANGMSG CDQSTVESLA DDPTDSPFDA DDCLKVRKYW
60 70 80 90 100
CFLLSSIFTF LAGLLVVLLW RAFAFVCCRK EPDLGPNDPK QKEQKASRNK
110 120 130 140 150
QEFEGTFMTE AKDWAGELIS GQTTTGRILV VLVFILSIAS LIIYFVDASS
160 170 180 190 200
EEVERCQKWS NNITQQIDLA FNIFFMVYFF IRFIAASDKL WFMLEMYSFV
210 220 230 240 250
DYFTIPPSFV SIYLDRTWIG LRFLRALRLM TVPDILQYLN VLKTSSSIRL
260 270 280 290 300
AQLVSIFISV WLTAAGIIHL LENSGDPLDF NNAHRLSYWT CVYFLIVTMS
310 320 330 340 350
TVGYGDVYCE TVLGRTFLVF FLLVGLAMFA SSIPEIIELV GSGNKYGGEL
360 370 380 390 400
KREHGKRHIV VCGHITYESV SHFLKDFLHE DREDVDVEVV FLHRKPPDLE
410 420 430 440 450
LEGLFKRHFT TVEFFQGTIM NPIDLQRVKV HEADACLVLA NKYCQDPDAE
460 470 480 490 500
DAANIMRVIS IKNYSDDIRV IIQLMQYHNK AYLLNIPSWD WKQGDDVICL
510 520 530 540 550
AELKLGFIAQ SCLAPGFSTM MANLFAMRSF KTSPDMQSWT NDYLRGTGME
560 570 580 590 600
MYTETLSPTF IGIPFAQATE LCFSKLKLLL LAIEIKGAEE GADSKISINP
610 620 630 640 650
RGAKIQANTQ GFFIAQSADE VKRAWFYCKA CHEDIKDETL IKKCKCKNLT
660 670 680 690 700
VQPRSKFDDL DEHHPAPTFT PPELPKRVHV RGSVSGDITR DREDTNLLNR
710 720 730 740 750
NVRRPNGTGN GTGGMHHMNN TAAAAAAAAA AGKQVNKVKP TVNVSRQVEG
760 770 780 790 800
QVISPSQYNR PTSRSSGTGT QNQNGGVSLP AGIADDQSKD FDFEKTEMKY
810 820 830 840 850
DSTGMFHWSP AKSLEDCILD RNQAAMTVLN GHVVVCLFAD PDSPLIGLRN
860 870 880 890 900
LVMPLRASNF HYHELKHVVI VGSVDYIRRE WKMLQNLPKI SVLNGSPLSR
910 920 930 940 950
ADLRAVNVNL CDMCCILSAK VPSNDDPTLA DKEAILASLN IKAMTFDDTI
960 970 980 990 1000
GVLSQRGPEF DNLSATAGSP IVLQRRGSVY GANVPMITEL VNDSNVQFLD
1010 1020 1030 1040 1050
QDDDDDPDTE LYLTQPFACG TAFAVSVLDS LMSTTYFNQN ALTLIRSLIT
1060 1070 1080 1090 1100
GGATPELELI LAEGAGLRGG YSTVESLSNR DRCRVGQISL YDGPLAQFGE
1110 1120 1130 1140 1150
CGKYGDLFVA ALKSYGMLCI GLYRFRDTSS SCDASSKRYV ITNPPDDFSL
1160 1170 1180 1190 1200
LPTDQVFVLM QFDPGLEYKP PAVRAPAGGR GTNTQGSGVG GGGSNKDDNS
Length:1,200
Mass (Da):133,102
Last modified:September 19, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i306A12234C63AD0D
GO
Isoform 2 (identifier: Q03720-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAKDDEYSLSN
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,235
Mass (Da):136,974
Checksum:i66119577C4671293
GO
Isoform 3 (identifier: Q03720-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,222
Mass (Da):135,596
Checksum:i2524894C531A23E2
GO
Isoform 5 (identifier: Q03720-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-426: PPDLELEGLFKRHFTTVEFFQGTIMNPIDLQ → EPDLELEGLLKRHYTTVAFFQGTMMNAVDLE
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAKDDEYSLSN
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,235
Mass (Da):136,842
Checksum:i78F5124596264C04
GO
Isoform 6 (identifier: Q03720-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     396-426: PPDLELEGLFKRHFTTVEFFQGTIMNPIDLQ → EPDLELEGLLKRHYTTVAFFQGTMMNAVDLE
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAN
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,210
Mass (Da):134,308
Checksum:i57CAD7C7319040E1
GO
Isoform A (identifier: Q03720-5) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,329
Checksum:i5F3D3DF608925F11
GO
Isoform B (identifier: Q03720-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.

Show »
Length:1,183
Mass (Da):131,421
Checksum:i8E015F553A173BD3
GO
Isoform C (identifier: Q03720-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS

Show »
Length:1,183
Mass (Da):131,354
Checksum:iC7CF028A72DEB2EC
GO
Isoform D (identifier: Q03720-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-355: MFASSIPEIIELVGSGNKYGGELKREHG → VFASWIPEITELAAQRSKYGGTYSKDPR
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,481
Checksum:iCA329D9F19769C07
GO
Isoform E (identifier: Q03720-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,346
Checksum:i303BFBDD056C3F5E
GO
Isoform F (identifier: Q03720-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-426: PPDLELEGLFKRHFTTVEFFQGTIMNPIDLQ → EPDLELEGLLKRHYTTVAFFQGTMMNAVDLE
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,264
Checksum:i24E95ABD6025A0CE
GO
Isoform H (identifier: Q03720-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,262
Checksum:i7EAADDEF4520F7DC
GO
Isoform I (identifier: Q03720-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAKDDEYSLSN

Show »
Length:1,213
Mass (Da):134,481
Checksum:iE80AAC5510D907E8
GO
Isoform J (identifier: Q03720-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     650-686: TVQPRSKFDDLDEHHPAPTFTPPELPKRVHVRGSVSG → ATFRKGVRAVQMVGRAS

Show »
Length:1,180
Mass (Da):130,801
Checksum:iE4ED321A7EFE2662
GO
Isoform K (identifier: Q03720-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     661-697: DEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNL → V

Show »
Length:1,164
Mass (Da):129,042
Checksum:i178E53434D1DE087
GO
Isoform L (identifier: Q03720-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-685: LTVQPRSKFDDLDEHHPAPTFTPPELPKRVHVRGSVS → YVGMIMMQTGMVNQGITSVMNTME

Show »
Length:1,187
Mass (Da):131,577
Checksum:i9CAEDDAB27913D0A
GO
Isoform M (identifier: Q03720-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     661-685: Missing.
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,197
Mass (Da):132,823
Checksum:iAE414DF14B75B7F2
GO
Isoform O (identifier: Q03720-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-697: DEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNL → V

Show »
Length:1,164
Mass (Da):128,974
Checksum:iBD5D193C28635C0A
GO
Isoform P (identifier: Q03720-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-697: DEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNL → V

Show »
Length:1,164
Mass (Da):128,991
Checksum:iD9C70FAE1B9F54D1
GO
Isoform Q (identifier: Q03720-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,279
Checksum:i11AC1BC448DE9793
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1JIV7E1JIV7_DROME
Slowpoke, isoform S
slo BcDNA:GH10751, Dmel\CG10693, Dslo, dSlo, dslo
1,210Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KHT2A0A0B4KHT2_DROME
Slowpoke, isoform T
slo BcDNA:GH10751, Dmel\CG10693, Dslo, dSlo, dslo
1,217Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KGV3A0A0B4KGV3_DROME
Slowpoke, isoform V
slo BcDNA:GH10751, Dmel\CG10693, Dslo, dSlo, dslo
1,135Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KHF8A0A0B4KHF8_DROME
Slowpoke, isoform W
slo BcDNA:GH10751, Dmel\CG10693, Dslo, dSlo, dslo
1,159Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KI08A0A0B4KI08_DROME
Slowpoke, isoform X
slo BcDNA:GH10751, Dmel\CG10693, Dslo, dSlo, dslo
1,152Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KGZ3A0A0B4KGZ3_DROME
Slowpoke, isoform U
slo BcDNA:GH10751, Dmel\CG10693, Dslo, dSlo, dslo
1,191Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA28902 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAO45232 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81E → R in AAC47020 (PubMed:8774450).Curated1
Sequence conflicti81E → R in AAC47021 (PubMed:8774450).Curated1
Sequence conflicti281N → D in AAA28902 (PubMed:1857984).Curated1
Sequence conflicti281N → D in AAA28651 (PubMed:1497890).Curated1
Sequence conflicti281N → D in AAO45232 (PubMed:12537569).Curated1
Sequence conflicti994S → G in AAA28902 (PubMed:1857984).Curated1
Sequence conflicti994S → G in AAA28651 (PubMed:1497890).Curated1
Sequence conflicti994S → G in AAO45232 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0099991 – 17Missing in isoform 6, isoform B and isoform C. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_010000328 – 356MFASS…REHGK → IFASCIPEIIDLIGTRAKYG GTLKNEKGR in isoform 6, isoform E, isoform P and isoform Q. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_020625328 – 355MFASS…KREHG → VFASWIPEITELAAQRSKYG GTYSKDPR in isoform D. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_010001396 – 426PPDLE…PIDLQ → EPDLELEGLLKRHYTTVAFF QGTMMNAVDLE in isoform 5, isoform 6 and isoform F. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_010002536 – 569MQSWT…FAQAT → TQAWQNDYLQGTGCEMYTET LSPSFTGMTFPQAS in isoform 5, isoform C, isoform H, isoform O, isoform P and isoform Q. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020626649 – 685LTVQP…RGSVS → YVGMIMMQTGMVNQGITSVM NTME in isoform L. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_020627650 – 686TVQPR…GSVSG → ATFRKGVRAVQMVGRAS in isoform J. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_050267650 – 661TVQPR…FDDLD → ATFRKGVRAVQMVGRAKDDE YSLSN in isoform 2, isoform 5 and isoform I. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_010003650 – 661TVQPR…FDDLD → ATFRKGVRAVQMVGRAN in isoform 6. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_020628661 – 697DEHHP…EDTNL → V in isoform K, isoform O and isoform P. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_010004661 – 685Missing in isoform A, isoform D, isoform E, isoform F, isoform H, isoform M and isoform Q. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_050268761P → PPENDANPYAGYQLAYEVKK LMP in isoform 2, isoform 3, isoform 5, isoform 6 and isoform M. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M69053 mRNA Translation: AAA28902.1 Different initiation.
M96840 mRNA Translation: AAA28651.1
AE014297 Genomic DNA Translation: AAF56324.1
AE014297 Genomic DNA Translation: AAN14013.1
AE014297 Genomic DNA Translation: AAS65211.1
AE014297 Genomic DNA Translation: AAX52977.1
AE014297 Genomic DNA Translation: AAX52978.1
AE014297 Genomic DNA Translation: AAX52979.1
AE014297 Genomic DNA Translation: AAX52980.2
AE014297 Genomic DNA Translation: AAX52981.1
AE014297 Genomic DNA Translation: AAX52982.1
AE014297 Genomic DNA Translation: AAX52983.1
AE014297 Genomic DNA Translation: AAX52984.1
AE014297 Genomic DNA Translation: AAX52985.1
AE014297 Genomic DNA Translation: AAX52986.1
AE014297 Genomic DNA Translation: AAX52987.1
AE014297 Genomic DNA Translation: AAX52988.1
AE014297 Genomic DNA Translation: AAX52989.1
AE014297 Genomic DNA Translation: AAX52990.1
BT004876 mRNA Translation: AAO45232.1 Frameshift.
U40315 Genomic DNA Translation: AAC47020.1
U40315 Genomic DNA Translation: AAC47021.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A39800
C39800
JH0697
PS0438
PS0439
PS0440
PS0441
PS0446

NCBI Reference Sequences

More...
RefSeqi
NP_001014651.1, NM_001014651.3 [Q03720-20]
NP_001014652.1, NM_001014652.3 [Q03720-19]
NP_001014653.1, NM_001014653.3 [Q03720-18]
NP_001014654.1, NM_001014654.3 [Q03720-1]
NP_001014655.1, NM_001014655.3 [Q03720-17]
NP_001014656.1, NM_001014656.3 [Q03720-16]
NP_001014657.1, NM_001014657.3 [Q03720-15]
NP_001014658.1, NM_001014658.3 [Q03720-14]
NP_001014659.1, NM_001014659.3 [Q03720-13]
NP_001014660.1, NM_001014660.3 [Q03720-12]
NP_001014661.2, NM_001014661.4 [Q03720-3]
NP_001014662.1, NM_001014662.3 [Q03720-11]
NP_001014663.1, NM_001014663.3 [Q03720-10]
NP_001014664.1, NM_001014664.3 [Q03720-9]
NP_524486.2, NM_079762.4 [Q03720-5]
NP_733029.1, NM_170164.4 [Q03720-7]
NP_996289.1, NM_206566.4 [Q03720-8]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0084683; FBpp0084063; FBgn0003429 [Q03720-7]
FBtr0084684; FBpp0084064; FBgn0003429 [Q03720-5]
FBtr0084685; FBpp0089227; FBgn0003429 [Q03720-8]
FBtr0100622; FBpp0100082; FBgn0003429 [Q03720-9]
FBtr0100623; FBpp0100083; FBgn0003429 [Q03720-10]
FBtr0100624; FBpp0100084; FBgn0003429 [Q03720-11]
FBtr0100627; FBpp0100086; FBgn0003429 [Q03720-12]
FBtr0100629; FBpp0100089; FBgn0003429 [Q03720-13]
FBtr0100631; FBpp0100091; FBgn0003429 [Q03720-14]
FBtr0100632; FBpp0100092; FBgn0003429 [Q03720-15]
FBtr0100633; FBpp0100093; FBgn0003429 [Q03720-16]
FBtr0100634; FBpp0100094; FBgn0003429 [Q03720-17]
FBtr0100635; FBpp0100095; FBgn0003429 [Q03720-1]
FBtr0100636; FBpp0100096; FBgn0003429 [Q03720-18]
FBtr0100637; FBpp0100097; FBgn0003429 [Q03720-19]
FBtr0100638; FBpp0100098; FBgn0003429 [Q03720-20]
FBtr0301581; FBpp0290796; FBgn0003429 [Q03720-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
42940

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG10693

UCSC genome browser

More...
UCSCi
CG10693-RA d. melanogaster
CG10693-RG d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M69053 mRNA Translation: AAA28902.1 Different initiation.
M96840 mRNA Translation: AAA28651.1
AE014297 Genomic DNA Translation: AAF56324.1
AE014297 Genomic DNA Translation: AAN14013.1
AE014297 Genomic DNA Translation: AAS65211.1
AE014297 Genomic DNA Translation: AAX52977.1
AE014297 Genomic DNA Translation: AAX52978.1
AE014297 Genomic DNA Translation: AAX52979.1
AE014297 Genomic DNA Translation: AAX52980.2
AE014297 Genomic DNA Translation: AAX52981.1
AE014297 Genomic DNA Translation: AAX52982.1
AE014297 Genomic DNA Translation: AAX52983.1
AE014297 Genomic DNA Translation: AAX52984.1
AE014297 Genomic DNA Translation: AAX52985.1
AE014297 Genomic DNA Translation: AAX52986.1
AE014297 Genomic DNA Translation: AAX52987.1
AE014297 Genomic DNA Translation: AAX52988.1
AE014297 Genomic DNA Translation: AAX52989.1
AE014297 Genomic DNA Translation: AAX52990.1
BT004876 mRNA Translation: AAO45232.1 Frameshift.
U40315 Genomic DNA Translation: AAC47020.1
U40315 Genomic DNA Translation: AAC47021.1
PIRiA39800
C39800
JH0697
PS0438
PS0439
PS0440
PS0441
PS0446
RefSeqiNP_001014651.1, NM_001014651.3 [Q03720-20]
NP_001014652.1, NM_001014652.3 [Q03720-19]
NP_001014653.1, NM_001014653.3 [Q03720-18]
NP_001014654.1, NM_001014654.3 [Q03720-1]
NP_001014655.1, NM_001014655.3 [Q03720-17]
NP_001014656.1, NM_001014656.3 [Q03720-16]
NP_001014657.1, NM_001014657.3 [Q03720-15]
NP_001014658.1, NM_001014658.3 [Q03720-14]
NP_001014659.1, NM_001014659.3 [Q03720-13]
NP_001014660.1, NM_001014660.3 [Q03720-12]
NP_001014661.2, NM_001014661.4 [Q03720-3]
NP_001014662.1, NM_001014662.3 [Q03720-11]
NP_001014663.1, NM_001014663.3 [Q03720-10]
NP_001014664.1, NM_001014664.3 [Q03720-9]
NP_524486.2, NM_079762.4 [Q03720-5]
NP_733029.1, NM_170164.4 [Q03720-7]
NP_996289.1, NM_206566.4 [Q03720-8]

3D structure databases

SMRiQ03720
ModBaseiSearch...

Protein-protein interaction databases

BioGridi67865, 11 interactors
IntActiQ03720, 9 interactors
STRINGi7227.FBpp0303318

Protein family/group databases

TCDBi1.A.1.3.1 the voltage-gated ion channel (vic) superfamily

PTM databases

iPTMnetiQ03720

Proteomic databases

PRIDEiQ03720

Genome annotation databases

EnsemblMetazoaiFBtr0084683; FBpp0084063; FBgn0003429 [Q03720-7]
FBtr0084684; FBpp0084064; FBgn0003429 [Q03720-5]
FBtr0084685; FBpp0089227; FBgn0003429 [Q03720-8]
FBtr0100622; FBpp0100082; FBgn0003429 [Q03720-9]
FBtr0100623; FBpp0100083; FBgn0003429 [Q03720-10]
FBtr0100624; FBpp0100084; FBgn0003429 [Q03720-11]
FBtr0100627; FBpp0100086; FBgn0003429 [Q03720-12]
FBtr0100629; FBpp0100089; FBgn0003429 [Q03720-13]
FBtr0100631; FBpp0100091; FBgn0003429 [Q03720-14]
FBtr0100632; FBpp0100092; FBgn0003429 [Q03720-15]
FBtr0100633; FBpp0100093; FBgn0003429 [Q03720-16]
FBtr0100634; FBpp0100094; FBgn0003429 [Q03720-17]
FBtr0100635; FBpp0100095; FBgn0003429 [Q03720-1]
FBtr0100636; FBpp0100096; FBgn0003429 [Q03720-18]
FBtr0100637; FBpp0100097; FBgn0003429 [Q03720-19]
FBtr0100638; FBpp0100098; FBgn0003429 [Q03720-20]
FBtr0301581; FBpp0290796; FBgn0003429 [Q03720-3]
GeneIDi42940
KEGGidme:Dmel_CG10693
UCSCiCG10693-RA d. melanogaster
CG10693-RG d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
42940
FlyBaseiFBgn0003429 slo

Phylogenomic databases

GeneTreeiENSGT00940000168407
InParanoidiQ03720
KOiK04936
PhylomeDBiQ03720

Enzyme and pathway databases

ReactomeiR-DME-1300642 Sperm Motility And Taxes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
slo fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
42940

Protein Ontology

More...
PROi
PR:Q03720

Gene expression databases

BgeeiFBgn0003429 Expressed in head and 13 other tissues
ExpressionAtlasiQ03720 baseline and differential
GenevisibleiQ03720 DM

Family and domain databases

Gene3Di1.20.120.350, 1 hit
InterProiView protein in InterPro
IPR024939 Ca-act_K_channel_Slo-1
IPR005821 Ion_trans_dom
IPR003929 K_chnl_BK_asu
IPR036291 NAD(P)-bd_dom_sf
IPR027359 Volt_channel_dom_sf
PANTHERiPTHR10027:SF28 PTHR10027:SF28, 1 hit
PfamiView protein in Pfam
PF03493 BK_channel_a, 1 hit
PF00520 Ion_trans, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSLO_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q03720
Secondary accession number(s): A4V3D4
, Q24369, Q24384, Q24385, Q59DU0, Q59DU1, Q59DU2, Q59DU3, Q59DU4, Q59DU5, Q59DU6, Q59DU7, Q59DU8, Q59DU9, Q59DV0, Q59DV1, Q59DV2, Q7JP74, Q7KS13, Q86NK5, Q8IMV9, Q9TWA1, Q9VC51
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: September 19, 2006
Last modified: April 22, 2020
This is version 181 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again