Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gephyrin

Gene

Gphn

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-associated protein involved in membrane protein-cytoskeleton interactions. It is thought to anchor the inhibitory glycine receptor (GLYR) to subsynaptic microtubules (PubMed:8264797). Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released (PubMed:9990024).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by copper and tungsten.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: molybdopterin biosynthesis

This protein is involved in the pathway molybdopterin biosynthesis, which is part of Cofactor biosynthesis.1 Publication
View all proteins of this organism that are known to be involved in the pathway molybdopterin biosynthesis and in Cofactor biosynthesis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMultifunctional enzyme, Transferase
Biological processMolybdenum cofactor biosynthesis
LigandATP-binding, Magnesium, Metal-binding, Molybdenum, Nucleotide-binding

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00344

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gephyrin
Alternative name(s):
Putative glycine receptor-tubulin linker protein
Including the following 2 domains:
Molybdopterin adenylyltransferase (EC:2.7.7.751 Publication)
Short name:
MPT adenylyltransferase
Alternative name(s):
Domain G
Molybdopterin molybdenumtransferase (EC:2.10.1.11 Publication)
Short name:
MPT Mo-transferase
Alternative name(s):
Domain E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Gphn
Synonyms:Gph
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
69194 Gphn

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi362F → A: Reduced GLRB binding. 1 Publication1
Mutagenesisi745 – 746PP → AA: Reduced GLRB binding. 1 Publication2
Mutagenesisi745P → A: Loss of GLRB binding. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001709651 – 768GephyrinAdd BLAST768

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei201PhosphoserineCombined sources1
Modified residuei207PhosphoserineCombined sources1
Modified residuei211PhosphothreonineBy similarity1
Modified residuei213PhosphoserineBy similarity1
Modified residuei275PhosphoserineBy similarity1
Modified residuei278PhosphothreonineBy similarity1
Modified residuei279PhosphothreonineBy similarity1
Modified residuei281PhosphoserineBy similarity1
Modified residuei283PhosphoserineCombined sources1
Modified residuei337PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated.

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q03555

PRoteomics IDEntifications database

More...
PRIDEi
Q03555

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q03555

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q03555

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q03555

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in tissues including spinal cord, brain, liver, kidney and lung.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer, homodimer and homooligomer (PubMed:11325967, PubMed:25137389, PubMed:25531214). Interacts with SRGAP2 (via SH3 domain) (By similarity). Interacts with GLRB (PubMed:15201864, PubMed:16511563, PubMed:25137389, PubMed:25531214). Interacts with GABARAP (PubMed:10900017). Interacts with GABRA3 (PubMed:25531214). GABRA3 and GLRB occupy overlapping binding sites (PubMed:25531214). Interacts with ARHGAP32; IQSEC3, INSYN1 and INSYN2 (By similarity).By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
249211, 8 interactors

Database of interacting proteins

More...
DIPi
DIP-33263N

Protein interaction database and analysis system

More...
IntActi
Q03555, 9 interactors

Molecular INTeraction database

More...
MINTi
Q03555

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1768
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IHCX-ray1.90A1-201[»]
1T3EX-ray3.25A/B348-768[»]
2FTSX-ray2.41A350-768[»]
2FU3X-ray2.70A/B350-768[»]
4PD0X-ray1.70A350-768[»]
4PD1X-ray1.98A350-768[»]
4TK1X-ray2.70A/B350-768[»]
4TK2X-ray4.10A/B350-768[»]
4TK3X-ray2.70A/B350-768[»]
4TK4X-ray3.60A/B350-768[»]
4U90X-ray2.00A350-768[»]
4U91X-ray2.00A350-768[»]
5ERQX-ray1.55A350-768[»]
5ERRX-ray1.65A350-768[»]
5ERSX-ray1.70A350-768[»]
5ERTX-ray2.00A350-768[»]
5ERUX-ray1.60A350-768[»]
5ERVX-ray1.80A350-768[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q03555

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q03555

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q03555

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni14 – 166MPT Mo-transferaseAdd BLAST153
Regioni153 – 348Interaction with GABARAP1 PublicationAdd BLAST196
Regioni326 – 768MPT adenylyltransferaseAdd BLAST443

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi213 – 218Glu-rich (acidic)6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the N-terminal section; belongs to the MoaB/Mog family.Curated
In the C-terminal section; belongs to the MoeA family.Curated

Phylogenomic databases

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000280651

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005828

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q03555

KEGG Orthology (KO)

More...
KOi
K15376

Database of Orthologous Groups

More...
OrthoDBi
1114121at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q03555

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00887 MoeA, 1 hit
cd00886 MogA_MoaB, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.340.10, 1 hit
3.40.980.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036425 MoaB/Mog-like_dom_sf
IPR001453 MoaB/Mog_dom
IPR008284 MoCF_biosynth_CS
IPR038987 MoeA-like
IPR005111 MoeA_C_domain_IV
IPR036688 MoeA_C_domain_IV_sf
IPR005110 MoeA_linker/N
IPR036135 MoeA_linker/N_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10192 PTHR10192, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00994 MoCF_biosynth, 2 hits
PF03454 MoeA_C, 1 hit
PF03453 MoeA_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00852 MoCF_biosynth, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53218 SSF53218, 2 hits
SSF63867 SSF63867, 1 hit
SSF63882 SSF63882, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00177 molyb_syn, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01078 MOCF_BIOSYNTHESIS_1, 1 hit
PS01079 MOCF_BIOSYNTHESIS_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 6 (identifier: Q03555-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATEGMILTN HDHQIRVGVL TVSDSCFRNL AEDRSGINLK DLVQDPSLLG
60 70 80 90 100
GTISAYKIVP DEIEEIKETL IDWCDEKELN LILTTGGTGF APRDVTPEKF
110 120 130 140 150
PTFPFCGLQK GATKEVIERE APGMALAMLM GSLNVTPLGM LSRPVCGIRG
160 170 180 190 200
KTLIINLPGS KKGSQECFQF ILPALPHAID LLRDAIVKVK EVHDELEDLP
210 220 230 240 250
SPPPPLSPPP TTSPHKQTED KGVQCEEEEE EKKDSGVAST EDSSSSHITA
260 270 280 290 300
AALAAKIPDS IISRGVQVLP RDTASLSTTP SESPRAQATS RLSTASCPTP
310 320 330 340 350
KQIRRPDESK GVASRVGSLK VQSRCSSKEN ILRASHSAVD ITKVARRHRM
360 370 380 390 400
SPFPLTSMDK AFITVLEMTP VLGTEIINYR DGMGRVLAQD VYAKDNLPPF
410 420 430 440 450
PASVKDGYAV RAADGPGDRF IIGESQAGEQ PTQTVMPGQV MRVTTGAPIP
460 470 480 490 500
CGADAVVQVE DTELIRESDD GTEELEVRIL VQARPGQDIR PIGHDIKRGE
510 520 530 540 550
CVLAKGTHMG PSEIGLLATV GVTEVEVNKF PVVAVMSTGN ELLNPEDDLL
560 570 580 590 600
PGKIRDSNRS TLLATIQEHG YPTINLGIVG DNPDDLLNAL NEGISRADVI
610 620 630 640 650
ITSGGVSMGE KDYLKQVLDI DLHAQIHFGR VFMKPGLPTT FATLDIDGVR
660 670 680 690 700
KIIFALPGNP VSAVVTCNLF VVPALRKMQG ILDPRPTIIK ARLSCDVKLD
710 720 730 740 750
PRPEYHRCIL TWHHQEPLPW AQSTGNQMSS RLMSMRSANG LLMLPPKTEQ
760
YVELHKGEVV DVMVIGRL
Length:768
Mass (Da):83,266
Last modified:May 16, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFAD1B6DD76ED79EA
GO
Isoform 1 (identifier: Q03555-2) [UniParc]FASTAAdd to basket
Also known as: GE124'56

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MATEGMILTNHDHQIRVGVLTV → MSFPLSPAFTLLHILV

Show »
Length:762
Mass (Da):82,616
Checksum:iCF467AB5D3BE99BE
GO
Isoform 2 (identifier: Q03555-3) [UniParc]FASTAAdd to basket
Also known as: GE236

The sequence of this isoform differs from the canonical sequence as follows:
     99-111: Missing.
     256-256: K → KNHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR
     302-320: Missing.

Show »
Length:772
Mass (Da):83,638
Checksum:iD25D2294184BE3D4
GO
Isoform 3 (identifier: Q03555-4) [UniParc]FASTAAdd to basket
Also known as: GE24'6

The sequence of this isoform differs from the canonical sequence as follows:
     99-111: Missing.

Show »
Length:755
Mass (Da):81,814
Checksum:i219EC28CC2910AC1
GO
Isoform 4 (identifier: Q03555-5) [UniParc]FASTAAdd to basket
Also known as: GE245

The sequence of this isoform differs from the canonical sequence as follows:
     302-315: QIRRPDESKGVASR → ARLPSCSSTYSVSE
     316-320: Missing.

Show »
Length:763
Mass (Da):82,669
Checksum:i5E6039E40BDA68ED
GO
Isoform 5 (identifier: Q03555-6) [UniParc]FASTAAdd to basket
Also known as: GE26

The sequence of this isoform differs from the canonical sequence as follows:
     99-111: Missing.
     302-320: Missing.

Show »
Length:736
Mass (Da):79,748
Checksum:iB3817E1BE1D4D41B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R423M0R423_RAT
Gephyrin
Gphn
666Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1MA86F1MA86_RAT
Gephyrin
Gphn
620Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti255A → R (PubMed:11083919).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0032381 – 22MATEG…GVLTV → MSFPLSPAFTLLHILV in isoform 1. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_00323999 – 111Missing in isoform 5, isoform 2 and isoform 3. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_003240256K → KNHPFYTSPAVFMANHGQPI PGLISYSHHATGSADKR in isoform 2. 1 Publication1
Alternative sequenceiVSP_003243302 – 320Missing in isoform 5 and isoform 2. 2 PublicationsAdd BLAST19
Alternative sequenceiVSP_003241302 – 315QIRRP…GVASR → ARLPSCSSTYSVSE in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_003242316 – 320Missing in isoform 4. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X66366 mRNA Translation: CAA47009.2

Protein sequence database of the Protein Information Resource

More...
PIRi
JH0681

NCBI Reference Sequences

More...
RefSeqi
NP_074056.2, NM_022865.3 [Q03555-6]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Rn.11032

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64845

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:64845

UCSC genome browser

More...
UCSCi
RGD:69194 rat [Q03555-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X66366 mRNA Translation: CAA47009.2
PIRiJH0681
RefSeqiNP_074056.2, NM_022865.3 [Q03555-6]
UniGeneiRn.11032

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IHCX-ray1.90A1-201[»]
1T3EX-ray3.25A/B348-768[»]
2FTSX-ray2.41A350-768[»]
2FU3X-ray2.70A/B350-768[»]
4PD0X-ray1.70A350-768[»]
4PD1X-ray1.98A350-768[»]
4TK1X-ray2.70A/B350-768[»]
4TK2X-ray4.10A/B350-768[»]
4TK3X-ray2.70A/B350-768[»]
4TK4X-ray3.60A/B350-768[»]
4U90X-ray2.00A350-768[»]
4U91X-ray2.00A350-768[»]
5ERQX-ray1.55A350-768[»]
5ERRX-ray1.65A350-768[»]
5ERSX-ray1.70A350-768[»]
5ERTX-ray2.00A350-768[»]
5ERUX-ray1.60A350-768[»]
5ERVX-ray1.80A350-768[»]
ProteinModelPortaliQ03555
SMRiQ03555
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi249211, 8 interactors
DIPiDIP-33263N
IntActiQ03555, 9 interactors
MINTiQ03555

PTM databases

iPTMnetiQ03555
PhosphoSitePlusiQ03555
SwissPalmiQ03555

Proteomic databases

jPOSTiQ03555
PRIDEiQ03555

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi64845
KEGGirno:64845
UCSCiRGD:69194 rat [Q03555-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10243
RGDi69194 Gphn

Phylogenomic databases

HOGENOMiHOG000280651
HOVERGENiHBG005828
InParanoidiQ03555
KOiK15376
OrthoDBi1114121at2759
PhylomeDBiQ03555

Enzyme and pathway databases

UniPathwayi
UPA00344

Miscellaneous databases

EvolutionaryTraceiQ03555

Protein Ontology

More...
PROi
PR:Q03555

Family and domain databases

CDDicd00887 MoeA, 1 hit
cd00886 MogA_MoaB, 1 hit
Gene3Di2.40.340.10, 1 hit
3.40.980.10, 2 hits
InterProiView protein in InterPro
IPR036425 MoaB/Mog-like_dom_sf
IPR001453 MoaB/Mog_dom
IPR008284 MoCF_biosynth_CS
IPR038987 MoeA-like
IPR005111 MoeA_C_domain_IV
IPR036688 MoeA_C_domain_IV_sf
IPR005110 MoeA_linker/N
IPR036135 MoeA_linker/N_sf
PANTHERiPTHR10192 PTHR10192, 1 hit
PfamiView protein in Pfam
PF00994 MoCF_biosynth, 2 hits
PF03454 MoeA_C, 1 hit
PF03453 MoeA_N, 1 hit
SMARTiView protein in SMART
SM00852 MoCF_biosynth, 2 hits
SUPFAMiSSF53218 SSF53218, 2 hits
SSF63867 SSF63867, 1 hit
SSF63882 SSF63882, 1 hit
TIGRFAMsiTIGR00177 molyb_syn, 2 hits
PROSITEiView protein in PROSITE
PS01078 MOCF_BIOSYNTHESIS_1, 1 hit
PS01079 MOCF_BIOSYNTHESIS_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGEPH_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q03555
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: May 16, 2006
Last modified: January 16, 2019
This is version 185 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again