Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (17 Jun 2020)
Sequence version 1 (01 Oct 1993)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein lin-3

Gene

lin-3

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable ligand for tyrosine kinase receptor let-23. Essential for vulval induction, where it acts downstream of the synthetic multivulva (synMuv) class genes (PubMed:1641037, PubMed:15455032, PubMed:16678779, PubMed:17891142). Probably by activating let-23, phospholipase plc-3 and inositol 1,4,5-trisphosphate receptor itr-1 signaling cascade, plays a role in ovulation by promoting gonadal sheath cell contractions and spermatheca dilatation during ovulation (PubMed:15194811, PubMed:9491893). Probably by regulating neuronal transmission in ALA neurons, mediates the decrease in pharyngeal pumping and locomotion during the quiescent state that precedes each larval molt, by activating receptor lin-23-mediated signaling cascade (PubMed:17891142).6 Publications
Essential for vulval induction; its activity on vulval precursor cells is partially dependent on rom-1.1 Publication
Essential for vulval induction; acts independently of rom-1.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • epidermal growth factor receptor binding Source: WormBase
  • growth factor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q03345

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein lin-3
Alternative name(s):
Abnormal cell lineage protein 3
Lethal protein 94
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:lin-3
Synonyms:let-94
ORF Names:F36H1.4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
F36H1.4a ; CE28021 ; WBGene00002992 ; lin-3
F36H1.4b ; CE18670 ; WBGene00002992 ; lin-3
F36H1.4c ; CE30348 ; WBGene00002992 ; lin-3
F36H1.4d ; CE40413 ; WBGene00002992 ; lin-3
F36H1.4e ; CE41535 ; WBGene00002992 ; lin-3
F36H1.4f ; CE42534 ; WBGene00002992 ; lin-3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini14 – 230ExtracellularSequence analysisAdd BLAST217
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei231 – 253HelicalSequence analysisAdd BLAST23
Topological domaini254 – 438CytoplasmicSequence analysisAdd BLAST185

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown in combination with double mutants for the class A and B synMuv genes lin-36;lin-15A, lin-8;lin-15B, lin-15AB, lin-35;lin-8, lin-8;lin-36, lin-8;lin-9, lin-8;lin-37 or dpl-1;lin-15A results in suppression of the synthetic multivulva phenotype.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 13Sequence analysisAdd BLAST13
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000763314 – 438Protein lin-3Add BLAST425

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi154 ↔ 164PROSITE-ProRule annotation
Disulfide bondi158 ↔ 182PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi161N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi184 ↔ 193PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
Q03345

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at all larval stages.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00002992 Expressed in multi-cellular organism and 6 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q03345 differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
43101, 11 interactors

STRING: functional protein association networks

More...
STRINGi
6239.F36H1.4f.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q03345

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini150 – 194EGF-likePROSITE-ProRule annotationAdd BLAST45

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q03345

Identification of Orthologs from Complete Genome Data

More...
OMAi
AINYSGH

Database of Orthologous Groups

More...
OrthoDBi
969485at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform aImported (identifier: Q03345-1) [UniParc]FASTAAdd to basket
Also known as: lin-3L1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRKMLLFCIL LLFMPQFTVS ESCLPSWFRQ ERSAPEQLQS AENAAENSGS
60 70 80 90 100
VPPDTSRNSL ETNEIGDAPS STSTPETPTE TTISEAGDDE KRTEEVAKEL
110 120 130 140 150
IEKEAEYEGE YEDEKVDEEV EEALKYNEDA TQDATSTLKP AVRKEIEKLK
160 170 180 190 200
EAKCKDYCHH NATCHVEVIF REDRVSAVVP SCHCPQGWEG TRCDRHYVQA
210 220 230 240 250
FYAPINGRYN VRLSTMSSTA QLLVQQSSTS AIPAFAFLIV MLIMFITIVV
260 270 280 290 300
YAYRRMSKRS DDMTYTMSHM CPPEAFNVLK TPNGRHIPVH QIPSCSYTIP
310 320 330 340 350
TPGTVPPNIS STPGSRIPTR QQAIRNNEQA RNNFFSILRS QGTIPSRSIN
360 370 380 390 400
DDDTPKHYKS VPRVEVSAIN YSGHIDFSTV SYQSTESEVS KASVTCPPPA
410 420 430
HTVINIELDS ADTNFRSPSR SSGEQGSPAT CEPMIRHT
Length:438
Mass (Da):48,924
Last modified:October 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3434C779D85B4501
GO
Isoform bImported (identifier: Q03345-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-20: Missing.

Show »
Length:436
Mass (Da):48,737
Checksum:i1540A8D7A3EC458E
GO
Isoform cImported (identifier: Q03345-3) [UniParc]FASTAAdd to basket
Also known as: lin-3S1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     211-225: Missing.

Show »
Length:423
Mass (Da):47,308
Checksum:i8747AC5FECB50AFA
GO
Isoform dImported (identifier: Q03345-4) [UniParc]FASTAAdd to basket
Also known as: lin-3XL1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     19-20: Missing.
     211-225: VRLSTMSSTAQLLVQ → GKTKKPLIFMVHHPNQTISTTPSSQDSEISSIFSGLYERIV

Show »
Length:462
Mass (Da):51,679
Checksum:i3B537773EF354750
GO
Isoform eImported (identifier: Q03345-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MRKMLLFCILLLFMPQFTVS → MFGKSIPERLLVAF

Show »
Length:432
Mass (Da):48,099
Checksum:i3CE614FAC9071551
GO
Isoform fImported (identifier: Q03345-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-20: Missing.
     225-225: Q → QGKTKKPLIFMVHHPNQTISTTPSSQDSEISSIFSGLYERIV

Show »
Length:477
Mass (Da):53,295
Checksum:iD2ECFA9BE08CE3D6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A061AEC4A0A061AEC4_CAEEL
EGF-like domain-containing protein
lin-3 CELE_F36H1.4, F36H1.4
464Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061AD43A0A061AD43_CAEEL
EGF-like domain-containing protein
lin-3 CELE_F36H1.4, F36H1.4
421Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0536231 – 20MRKML…QFTVS → MFGKSIPERLLVAF in isoform e. CuratedAdd BLAST20
Alternative sequenceiVSP_00139619 – 20Missing in isoform b, isoform d and isoform f. Curated2
Alternative sequenceiVSP_001397211 – 225Missing in isoform c. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_053622211 – 225VRLST…QLLVQ → GKTKKPLIFMVHHPNQTIST TPSSQDSEISSIFSGLYERI V in isoform d. CuratedAdd BLAST15
Alternative sequenceiVSP_053624225Q → QGKTKKPLIFMVHHPNQTIS TTPSSQDSEISSIFSGLYER IV in isoform f. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X68070 mRNA Translation: CAA48207.1
BX284604, AL032641 Genomic DNA Translation: CAA92997.2
BX284604, AL032641 Genomic DNA Translation: CAD27623.1
BX284604, AL032641 Genomic DNA Translation: CAD30434.1
BX284604, AL032641 Genomic DNA Translation: CAL44969.1
BX284604, AL032641 Genomic DNA Translation: CAP03133.1
BX284604, AL032641 Genomic DNA Translation: CAQ35042.1

Protein sequence database of the Protein Information Resource

More...
PIRi
D88826
S28263

NCBI Reference Sequences

More...
RefSeqi
NP_001076688.1, NM_001083219.2 [Q03345-4]
NP_001122777.1, NM_001129305.1 [Q03345-5]
NP_001122778.1, NM_001129306.2 [Q03345-6]
NP_741488.1, NM_171418.5 [Q03345-1]
NP_741489.1, NM_171918.5 [Q03345-3]
NP_741490.1, NM_171919.4 [Q03345-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F36H1.4a.1; F36H1.4a.1; WBGene00002992 [Q03345-1]
F36H1.4b.1; F36H1.4b.1; WBGene00002992 [Q03345-2]
F36H1.4b.2; F36H1.4b.2; WBGene00002992 [Q03345-2]
F36H1.4c.1; F36H1.4c.1; WBGene00002992 [Q03345-3]
F36H1.4d.1; F36H1.4d.1; WBGene00002992 [Q03345-4]
F36H1.4d.2; F36H1.4d.2; WBGene00002992 [Q03345-4]
F36H1.4e.1; F36H1.4e.1; WBGene00002992 [Q03345-5]
F36H1.4f.1; F36H1.4f.1; WBGene00002992 [Q03345-6]
F36H1.4f.2; F36H1.4f.2; WBGene00002992 [Q03345-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
178001

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_F36H1.4

UCSC genome browser

More...
UCSCi
F36H1.4a c. elegans [Q03345-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X68070 mRNA Translation: CAA48207.1
BX284604, AL032641 Genomic DNA Translation: CAA92997.2
BX284604, AL032641 Genomic DNA Translation: CAD27623.1
BX284604, AL032641 Genomic DNA Translation: CAD30434.1
BX284604, AL032641 Genomic DNA Translation: CAL44969.1
BX284604, AL032641 Genomic DNA Translation: CAP03133.1
BX284604, AL032641 Genomic DNA Translation: CAQ35042.1
PIRiD88826
S28263
RefSeqiNP_001076688.1, NM_001083219.2 [Q03345-4]
NP_001122777.1, NM_001129305.1 [Q03345-5]
NP_001122778.1, NM_001129306.2 [Q03345-6]
NP_741488.1, NM_171418.5 [Q03345-1]
NP_741489.1, NM_171918.5 [Q03345-3]
NP_741490.1, NM_171919.4 [Q03345-2]

3D structure databases

SMRiQ03345
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi43101, 11 interactors
STRINGi6239.F36H1.4f.1

Proteomic databases

PeptideAtlasiQ03345

Genome annotation databases

EnsemblMetazoaiF36H1.4a.1; F36H1.4a.1; WBGene00002992 [Q03345-1]
F36H1.4b.1; F36H1.4b.1; WBGene00002992 [Q03345-2]
F36H1.4b.2; F36H1.4b.2; WBGene00002992 [Q03345-2]
F36H1.4c.1; F36H1.4c.1; WBGene00002992 [Q03345-3]
F36H1.4d.1; F36H1.4d.1; WBGene00002992 [Q03345-4]
F36H1.4d.2; F36H1.4d.2; WBGene00002992 [Q03345-4]
F36H1.4e.1; F36H1.4e.1; WBGene00002992 [Q03345-5]
F36H1.4f.1; F36H1.4f.1; WBGene00002992 [Q03345-6]
F36H1.4f.2; F36H1.4f.2; WBGene00002992 [Q03345-6]
GeneIDi178001
KEGGicel:CELE_F36H1.4
UCSCiF36H1.4a c. elegans [Q03345-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
178001
WormBaseiF36H1.4a ; CE28021 ; WBGene00002992 ; lin-3
F36H1.4b ; CE18670 ; WBGene00002992 ; lin-3
F36H1.4c ; CE30348 ; WBGene00002992 ; lin-3
F36H1.4d ; CE40413 ; WBGene00002992 ; lin-3
F36H1.4e ; CE41535 ; WBGene00002992 ; lin-3
F36H1.4f ; CE42534 ; WBGene00002992 ; lin-3

Phylogenomic databases

InParanoidiQ03345
OMAiAINYSGH
OrthoDBi969485at2759

Enzyme and pathway databases

SignaLinkiQ03345

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q03345

Gene expression databases

BgeeiWBGene00002992 Expressed in multi-cellular organism and 6 other tissues
ExpressionAtlasiQ03345 differential

Family and domain databases

InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
SMARTiView protein in SMART
SM00181 EGF, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIN3_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q03345
Secondary accession number(s): G5ECQ0, G5ECS1, G5EFX0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: June 17, 2020
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again