Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peroxisome proliferator-activated receptor delta

Gene

PPARD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi71 – 145Nuclear receptorPROSITE-ProRule annotationAdd BLAST75
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri74 – 94NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri111 – 133NR C4-typePROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-200425 Import of palmitoyl-CoA into the mitochondrial matrix
R-HSA-204174 Regulation of pyruvate dehydrogenase (PDH) complex
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-5362517 Signaling by Retinoic Acid

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q03181

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q03181

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001645

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peroxisome proliferator-activated receptor delta
Short name:
PPAR-delta
Alternative name(s):
NUCI
Nuclear hormone receptor 1
Short name:
NUC1
Nuclear receptor subfamily 1 group C member 2
Peroxisome proliferator-activated receptor beta
Short name:
PPAR-beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPARD
Synonyms:NR1C2, PPARB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000112033.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9235 PPARD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600409 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q03181

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5467

Open Targets

More...
OpenTargetsi
ENSG00000112033

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33557

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3979

Drug and drug target database

More...
DrugBanki
DB04801 (11E)-OCTADEC-11-ENOIC ACID
DB07070 (2S)-2-{3-[({[2-fluoro-4-(trifluoromethyl)phenyl]carbonyl}amino)methyl]-4-methoxybenzyl}butanoic acid
DB07724 3-{5-methoxy-1-[(4-methoxyphenyl)sulfonyl]-1H-indol-3-yl}propanoic acid
DB01393 Bezafibrate
DB05187 GFT505
DB09462 Glycerin
DB03338 Heptyl-Beta-D-Glucopyranoside
DB00159 Icosapent
DB05188 KD3010
DB00605 Sulindac
DB00374 Treprostinil
DB08078 {4-[3-(4-acetyl-3-hydroxy-2-propylphenoxy)propoxy]phenoxy}acetic acid

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
594

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PPARD

Domain mapping of disease mutations (DMDM)

More...
DMDMi
417522

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000534861 – 441Peroxisome proliferator-activated receptor deltaAdd BLAST441

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q03181

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q03181

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q03181

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q03181

PeptideAtlas

More...
PeptideAtlasi
Q03181

PRoteomics IDEntifications database

More...
PRIDEi
Q03181

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58200
58201 [Q03181-2]
58202 [Q03181-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q03181

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q03181

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous with maximal levels in placenta and skeletal muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000112033 Expressed in 223 organ(s), highest expression level in vagina

CleanEx database of gene expression profiles

More...
CleanExi
HS_PPARD

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q03181 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q03181 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB017635

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with the retinoid X receptor.6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111463, 52 interactors

Protein interaction database and analysis system

More...
IntActi
Q03181, 13 interactors

Molecular INTeraction database

More...
MINTi
Q03181

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000310928

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q03181

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1441
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GWXX-ray2.50A/B171-441[»]
1Y0SX-ray2.65A/B170-441[»]
2AWHX-ray2.00A/B174-441[»]
2B50X-ray2.00A/B169-440[»]
2BAWX-ray2.30A/B175-441[»]
2ENVNMR-A72-146[»]
2GWXX-ray2.30A/B175-441[»]
2J14X-ray2.80A/B165-441[»]
2Q5GX-ray2.70A/B165-441[»]
2XYJX-ray2.30A/B165-441[»]
2XYWX-ray3.14A/B165-441[»]
2XYXX-ray2.70A/B165-441[»]
2ZNPX-ray3.00A/B170-441[»]
2ZNQX-ray2.65A/B170-441[»]
3D5FX-ray2.20A/B175-441[»]
3DY6X-ray2.90A/B171-441[»]
3ET2X-ray2.24A/B165-441[»]
3GWXX-ray2.40A/B171-441[»]
3GZ9X-ray2.00A171-439[»]
3OZ0X-ray3.00A165-441[»]
3PEQX-ray2.40A/B171-441[»]
3SP9X-ray2.30A/B173-441[»]
3TKMX-ray1.95A171-441[»]
5U3QX-ray1.50A/B170-441[»]
5U3RX-ray1.95A/B170-441[»]
5U3SX-ray2.00A/B170-441[»]
5U3TX-ray1.70A/B170-441[»]
5U3UX-ray2.10A/B170-441[»]
5U3VX-ray1.84A/B170-441[»]
5U3WX-ray1.80A/B170-441[»]
5U3XX-ray2.10A/B170-441[»]
5U3YX-ray1.90A/B170-441[»]
5U3ZX-ray1.72A/B170-441[»]
5U40X-ray2.00A/B170-441[»]
5U41X-ray1.90A/B170-441[»]
5U42X-ray1.70A/B170-441[»]
5U43X-ray1.90A/B170-441[»]
5U44X-ray2.15A/B170-441[»]
5U45X-ray1.95A/B170-441[»]
5U46X-ray2.00A/B170-441[»]
5XMXX-ray2.00A/B171-441[»]
5Y7XX-ray1.70A/B171-441[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q03181

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q03181

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q03181

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini211 – 439NR LBDPROSITE-ProRule annotationAdd BLAST229

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri74 – 94NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri111 – 133NR C4-typePROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3575 Eukaryota
ENOG410XRZC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156676

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261626

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106004

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q03181

KEGG Orthology (KO)

More...
KOi
K04504

Identification of Orthologs from Complete Genome Data

More...
OMAi
SLGMSHN

Database of Orthologous Groups

More...
OrthoDBi
1240230at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q03181

TreeFam database of animal gene trees

More...
TreeFami
TF316304

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003074 1Cnucl_rcpt
IPR003075 1Cnucl_rcpt_B
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01288 PROXISOMEPAR
PR01290 PROXISOMPABR
PR00398 STRDHORMONER
PR00047 STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48508 SSF48508, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q03181-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQPQEEAPE VREEEEKEEV AEAEGAPELN GGPQHALPSS SYTDLSRSSS
60 70 80 90 100
PPSLLDQLQM GCDGASCGSL NMECRVCGDK ASGFHYGVHA CEGCKGFFRR
110 120 130 140 150
TIRMKLEYEK CERSCKIQKK NRNKCQYCRF QKCLALGMSH NAIRFGRMPE
160 170 180 190 200
AEKRKLVAGL TANEGSQYNP QVADLKAFSK HIYNAYLKNF NMTKKKARSI
210 220 230 240 250
LTGKASHTAP FVIHDIETLW QAEKGLVWKQ LVNGLPPYKE ISVHVFYRCQ
260 270 280 290 300
CTTVETVREL TEFAKSIPSF SSLFLNDQVT LLKYGVHEAI FAMLASIVNK
310 320 330 340 350
DGLLVANGSG FVTREFLRSL RKPFSDIIEP KFEFAVKFNA LELDDSDLAL
360 370 380 390 400
FIAAIILCGD RPGLMNVPRV EAIQDTILRA LEFHLQANHP DAQYLFPKLL
410 420 430 440
QKMADLRQLV TEHAQMMQRI KKTETETSLH PLLQEIYKDM Y
Length:441
Mass (Da):49,903
Last modified:October 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i94FBB2A4B46521E8
GO
Isoform 2 (identifier: Q03181-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-361: DR → GE
     362-441: Missing.

Show »
Length:361
Mass (Da):40,406
Checksum:iF97757AC266EF8BA
GO
Isoform 3 (identifier: Q03181-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-43: EQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYT → HQR

Show »
Length:402
Mass (Da):45,764
Checksum:i52A73C33151BCF8A
GO
Isoform 4 (identifier: Q03181-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-141: Missing.

Note: No experimental confirmation available.
Show »
Length:343
Mass (Da):38,855
Checksum:i54FB19E6FCE3B21D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti79D → G in BAF84350 (PubMed:14702039).Curated1
Sequence conflicti134L → P in BAH02282 (PubMed:18619963).Curated1
Sequence conflicti191N → D in BAG65615 (PubMed:14702039).Curated1
Sequence conflicti217E → K in BAG65615 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0437872 – 43EQPQE…SSSYT → HQR in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_04610444 – 141Missing in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_010133360 – 361DR → GE in isoform 2. 1 Publication2
Alternative sequenceiVSP_010134362 – 441Missing in isoform 2. 1 PublicationAdd BLAST80

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L07592 mRNA Translation: AAA36469.1
AF246303
, AF246299, AF246300, AF246301, AF246302 Genomic DNA Translation: AAF62553.1
AB307691 mRNA Translation: BAH02282.1
AY919140 mRNA Translation: AAX14041.1
AK291661 mRNA Translation: BAF84350.1
AK296425 mRNA Translation: BAH12347.1
AK304878 mRNA Translation: BAG65615.1
AK122614 mRNA Translation: BAG53624.1
AY442342 Genomic DNA Translation: AAR05439.1
AL022721 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03825.1
BC002715 mRNA Translation: AAH02715.1
BC007578 mRNA Translation: AAH07578.1
AB099507 mRNA Translation: BAC78903.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4803.1 [Q03181-1]
CCDS4804.1 [Q03181-2]
CCDS54994.1 [Q03181-3]
CCDS54995.1 [Q03181-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A45360

NCBI Reference Sequences

More...
RefSeqi
NP_001165289.1, NM_001171818.1 [Q03181-1]
NP_001165290.1, NM_001171819.1 [Q03181-3]
NP_001165291.1, NM_001171820.1 [Q03181-4]
NP_006229.1, NM_006238.4 [Q03181-1]
NP_803184.1, NM_177435.2 [Q03181-2]
XP_005249250.1, XM_005249193.1 [Q03181-1]
XP_006715183.1, XM_006715120.1 [Q03181-1]
XP_006715186.1, XM_006715123.1 [Q03181-1]
XP_011513009.1, XM_011514707.1 [Q03181-1]
XP_011513011.1, XM_011514709.1
XP_011513012.1, XM_011514710.1 [Q03181-1]
XP_016866460.1, XM_017010971.1
XP_016866461.1, XM_017010972.1 [Q03181-1]
XP_016866462.1, XM_017010973.1 [Q03181-1]
XP_016866463.1, XM_017010974.1 [Q03181-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.696032

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000311565; ENSP00000310928; ENSG00000112033 [Q03181-1]
ENST00000337400; ENSP00000337063; ENSG00000112033 [Q03181-2]
ENST00000360694; ENSP00000353916; ENSG00000112033 [Q03181-1]
ENST00000418635; ENSP00000413314; ENSG00000112033 [Q03181-4]
ENST00000448077; ENSP00000414372; ENSG00000112033 [Q03181-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5467

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5467

UCSC genome browser

More...
UCSCi
uc003okm.3 human [Q03181-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Wikipedia

Peroxisome proliferator-activated receptor entry

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07592 mRNA Translation: AAA36469.1
AF246303
, AF246299, AF246300, AF246301, AF246302 Genomic DNA Translation: AAF62553.1
AB307691 mRNA Translation: BAH02282.1
AY919140 mRNA Translation: AAX14041.1
AK291661 mRNA Translation: BAF84350.1
AK296425 mRNA Translation: BAH12347.1
AK304878 mRNA Translation: BAG65615.1
AK122614 mRNA Translation: BAG53624.1
AY442342 Genomic DNA Translation: AAR05439.1
AL022721 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03825.1
BC002715 mRNA Translation: AAH02715.1
BC007578 mRNA Translation: AAH07578.1
AB099507 mRNA Translation: BAC78903.1
CCDSiCCDS4803.1 [Q03181-1]
CCDS4804.1 [Q03181-2]
CCDS54994.1 [Q03181-3]
CCDS54995.1 [Q03181-4]
PIRiA45360
RefSeqiNP_001165289.1, NM_001171818.1 [Q03181-1]
NP_001165290.1, NM_001171819.1 [Q03181-3]
NP_001165291.1, NM_001171820.1 [Q03181-4]
NP_006229.1, NM_006238.4 [Q03181-1]
NP_803184.1, NM_177435.2 [Q03181-2]
XP_005249250.1, XM_005249193.1 [Q03181-1]
XP_006715183.1, XM_006715120.1 [Q03181-1]
XP_006715186.1, XM_006715123.1 [Q03181-1]
XP_011513009.1, XM_011514707.1 [Q03181-1]
XP_011513011.1, XM_011514709.1
XP_011513012.1, XM_011514710.1 [Q03181-1]
XP_016866460.1, XM_017010971.1
XP_016866461.1, XM_017010972.1 [Q03181-1]
XP_016866462.1, XM_017010973.1 [Q03181-1]
XP_016866463.1, XM_017010974.1 [Q03181-1]
UniGeneiHs.696032

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GWXX-ray2.50A/B171-441[»]
1Y0SX-ray2.65A/B170-441[»]
2AWHX-ray2.00A/B174-441[»]
2B50X-ray2.00A/B169-440[»]
2BAWX-ray2.30A/B175-441[»]
2ENVNMR-A72-146[»]
2GWXX-ray2.30A/B175-441[»]
2J14X-ray2.80A/B165-441[»]
2Q5GX-ray2.70A/B165-441[»]
2XYJX-ray2.30A/B165-441[»]
2XYWX-ray3.14A/B165-441[»]
2XYXX-ray2.70A/B165-441[»]
2ZNPX-ray3.00A/B170-441[»]
2ZNQX-ray2.65A/B170-441[»]
3D5FX-ray2.20A/B175-441[»]
3DY6X-ray2.90A/B171-441[»]
3ET2X-ray2.24A/B165-441[»]
3GWXX-ray2.40A/B171-441[»]
3GZ9X-ray2.00A171-439[»]
3OZ0X-ray3.00A165-441[»]
3PEQX-ray2.40A/B171-441[»]
3SP9X-ray2.30A/B173-441[»]
3TKMX-ray1.95A171-441[»]
5U3QX-ray1.50A/B170-441[»]
5U3RX-ray1.95A/B170-441[»]
5U3SX-ray2.00A/B170-441[»]
5U3TX-ray1.70A/B170-441[»]
5U3UX-ray2.10A/B170-441[»]
5U3VX-ray1.84A/B170-441[»]
5U3WX-ray1.80A/B170-441[»]
5U3XX-ray2.10A/B170-441[»]
5U3YX-ray1.90A/B170-441[»]
5U3ZX-ray1.72A/B170-441[»]
5U40X-ray2.00A/B170-441[»]
5U41X-ray1.90A/B170-441[»]
5U42X-ray1.70A/B170-441[»]
5U43X-ray1.90A/B170-441[»]
5U44X-ray2.15A/B170-441[»]
5U45X-ray1.95A/B170-441[»]
5U46X-ray2.00A/B170-441[»]
5XMXX-ray2.00A/B171-441[»]
5Y7XX-ray1.70A/B171-441[»]
ProteinModelPortaliQ03181
SMRiQ03181
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111463, 52 interactors
IntActiQ03181, 13 interactors
MINTiQ03181
STRINGi9606.ENSP00000310928

Chemistry databases

BindingDBiQ03181
ChEMBLiCHEMBL3979
DrugBankiDB04801 (11E)-OCTADEC-11-ENOIC ACID
DB07070 (2S)-2-{3-[({[2-fluoro-4-(trifluoromethyl)phenyl]carbonyl}amino)methyl]-4-methoxybenzyl}butanoic acid
DB07724 3-{5-methoxy-1-[(4-methoxyphenyl)sulfonyl]-1H-indol-3-yl}propanoic acid
DB01393 Bezafibrate
DB05187 GFT505
DB09462 Glycerin
DB03338 Heptyl-Beta-D-Glucopyranoside
DB00159 Icosapent
DB05188 KD3010
DB00605 Sulindac
DB00374 Treprostinil
DB08078 {4-[3-(4-acetyl-3-hydroxy-2-propylphenoxy)propoxy]phenoxy}acetic acid
GuidetoPHARMACOLOGYi594
SwissLipidsiSLP:000001645

PTM databases

iPTMnetiQ03181
PhosphoSitePlusiQ03181

Polymorphism and mutation databases

BioMutaiPPARD
DMDMi417522

Proteomic databases

EPDiQ03181
jPOSTiQ03181
MaxQBiQ03181
PaxDbiQ03181
PeptideAtlasiQ03181
PRIDEiQ03181
ProteomicsDBi58200
58201 [Q03181-2]
58202 [Q03181-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5467
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311565; ENSP00000310928; ENSG00000112033 [Q03181-1]
ENST00000337400; ENSP00000337063; ENSG00000112033 [Q03181-2]
ENST00000360694; ENSP00000353916; ENSG00000112033 [Q03181-1]
ENST00000418635; ENSP00000413314; ENSG00000112033 [Q03181-4]
ENST00000448077; ENSP00000414372; ENSG00000112033 [Q03181-3]
GeneIDi5467
KEGGihsa:5467
UCSCiuc003okm.3 human [Q03181-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5467
DisGeNETi5467
EuPathDBiHostDB:ENSG00000112033.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPARD

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0165038
HGNCiHGNC:9235 PPARD
HPAiCAB017635
MIMi600409 gene
neXtProtiNX_Q03181
OpenTargetsiENSG00000112033
PharmGKBiPA33557

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00940000156676
HOGENOMiHOG000261626
HOVERGENiHBG106004
InParanoidiQ03181
KOiK04504
OMAiSLGMSHN
OrthoDBi1240230at2759
PhylomeDBiQ03181
TreeFamiTF316304

Enzyme and pathway databases

ReactomeiR-HSA-200425 Import of palmitoyl-CoA into the mitochondrial matrix
R-HSA-204174 Regulation of pyruvate dehydrogenase (PDH) complex
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-5362517 Signaling by Retinoic Acid
SignaLinkiQ03181
SIGNORiQ03181

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PPARD human
EvolutionaryTraceiQ03181

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Peroxisome_proliferator-activated_receptor_delta

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5467

Protein Ontology

More...
PROi
PR:Q03181

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000112033 Expressed in 223 organ(s), highest expression level in vagina
CleanExiHS_PPARD
ExpressionAtlasiQ03181 baseline and differential
GenevisibleiQ03181 HS

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR003074 1Cnucl_rcpt
IPR003075 1Cnucl_rcpt_B
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR01288 PROXISOMEPAR
PR01290 PROXISOMPABR
PR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPARD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q03181
Secondary accession number(s): A8K6J6
, B4E3V3, B6ZGS1, B7Z3W1, E9PE18, Q5D1P0, Q7Z5K0, Q9BUD4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: January 16, 2019
This is version 224 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again