Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cAMP-responsive element modulator

Gene

CREM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in spermatid maturation (PubMed:10373550).1 Publication
Isoform 6: May play a role in the regulation of the circadian clock: acts as a transcriptional repressor of the core circadian component PER1 by directly binding to cAMP response elements in its promoter.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding, Repressor
Biological processBiological rhythms, Differentiation, Spermatogenesis, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-400253 Circadian Clock
SignaLinkiQ03060
SIGNORiQ03060

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-responsive element modulatorCurated
Alternative name(s):
Inducible cAMP early repressor
Short name:
ICER
Gene namesi
Name:CREMImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000095794.19
HGNCiHGNC:2352 CREM
MIMi123812 gene
neXtProtiNX_Q03060

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1390
OpenTargetsiENSG00000095794
PharmGKBiPA26871

Polymorphism and mutation databases

BioMutaiCREM
DMDMi259016392

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000766071 – 345cAMP-responsive element modulatorAdd BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei102PhosphoserineBy similarity1
Modified residuei129PhosphoserineCombined sources1
Modified residuei271PhosphoserineCombined sources1
Modified residuei274PhosphoserineCombined sources1
Modified residuei277PhosphoserineCombined sources1

Post-translational modificationi

Isoform 9 is ubiquitinated by CDC34 and RAD6B in order to be degraded by the proteasome.1 Publication
Stimulated by phosphorylation. Phosphorylated on Ser-116 by TSSK4 in vitro.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ03060
PeptideAtlasiQ03060
PRIDEiQ03060
ProteomicsDBi58163
58164 [Q03060-1]
58165 [Q03060-10]
58166 [Q03060-11]
58167 [Q03060-12]
58168 [Q03060-13]
58169 [Q03060-14]
58170 [Q03060-15]
58171 [Q03060-16]
58172 [Q03060-17]
58173 [Q03060-19]
58174 [Q03060-2]
58175 [Q03060-20]
58176 [Q03060-21]
58177 [Q03060-22]
58178 [Q03060-23]
58179 [Q03060-24]
58180 [Q03060-25]
58181 [Q03060-6]
58182 [Q03060-7]
58183 [Q03060-8]
58184 [Q03060-9]

PTM databases

iPTMnetiQ03060
PhosphoSitePlusiQ03060

Expressioni

Tissue specificityi

Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes.3 Publications

Gene expression databases

BgeeiENSG00000095794 Expressed in 219 organ(s), highest expression level in right testis
ExpressionAtlasiQ03060 baseline and differential
GenevisibleiQ03060 HS

Organism-specific databases

HPAiCAB018352
HPA001818

Interactioni

Subunit structurei

Binds DNA as a dimer. Interacts with FHL5 (By similarity). Interacts with CDC34 (PubMed:10373550). May interact with TSSK4 (By similarity).By similarity1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107780, 26 interactors
IntActiQ03060, 28 interactors
MINTiQ03060

Structurei

3D structure databases

ProteinModelPortaliQ03060
SMRiQ03060
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini88 – 147KIDPROSITE-ProRule annotationAdd BLAST60
Domaini286 – 345bZIPPROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni287 – 312Basic motifPROSITE-ProRule annotationAdd BLAST26
Regioni314 – 335Leucine-zipperPROSITE-ProRule annotationAdd BLAST22

Sequence similaritiesi

Belongs to the bZIP family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000008655
HOGENOMiHOG000007365
HOVERGENiHBG011077
InParanoidiQ03060
KOiK09052
PhylomeDBiQ03060
TreeFamiTF106464

Family and domain databases

InterProiView protein in InterPro
IPR004827 bZIP
IPR003102 Coactivator_CBP_pKID
IPR001630 Leuzip_CREB
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PF02173 pKID, 1 hit
PRINTSiPR00041 LEUZIPPRCREB
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit
PS50953 KID, 1 hit

Sequences (29+)i

Sequence statusi: Complete.

This entry describes 29 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 29 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q03060-5) [UniParc]FASTAAdd to basket
Also known as: CREM-BCEFGgammaHIbeta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTMETVESQH DGSITASLTE SKSAHVQTQT GQNSIPALAQ VSVAGSGTRR
60 70 80 90 100
GSPAVTLVQL PSGQTIHVQG VIQTPQPWVI QSSEIHTVQV AAIAETDESA
110 120 130 140 150
ESEGVIDSHK RREILSRRPS YRKILNELSS DVPGVPKIEE ERSEEEGTPP
160 170 180 190 200
SIATMAVPTS IYQTSTGQYI AIAQGGTIQI SNPGSDGVQG LQALTMTNSG
210 220 230 240 250
APPPGATIVQ YAAQSADGTQ QFFVPGSQVV VQDEETELAP SHMAAATGDM
260 270 280 290 300
PTYQIRAPTA ALPQGVVMAA SPGSLHSPQQ LAEEATRKRE LRLMKNREAA
310 320 330 340
KECRRRKKEY VKCLESRVAV LEVQNKKLIE ELETLKDICS PKTDY
Note: Produced by alternative promoter usage.
Length:345
Mass (Da):37,006
Last modified:September 12, 2018 - v6
Checksum:i4DDEE62904CDD0E6
GO
Isoform 2 (identifier: Q03060-1) [UniParc]FASTAAdd to basket
Also known as: Beta, CREM-BCEFGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     233-244: Missing.

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:349
Mass (Da):37,628
Checksum:iF6B8D2BF073C00C0
GO
Isoform 3 (identifier: Q03060-6) [UniParc]FASTAAdd to basket
Also known as: CREM-BCEFGIalpha, Tau

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     233-244: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:348
Mass (Da):37,577
Checksum:i859AA3D3C2EB7D59
GO
Isoform 4 (identifier: Q03060-2) [UniParc]FASTAAdd to basket
Also known as: Alpha, CREM-BEFHIb, CREM-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     170-245: IAIAQGGTIQ...TELAPSHMAA → T

Note: Produced by alternative splicing of isoform 1.
Show »
Length:237
Mass (Da):26,320
Checksum:i89C1F372F6E60AF0
GO
Isoform 5 (identifier: Q03060-7) [UniParc]FASTAAdd to basket
Also known as: CREM-theta2tau-gamma, CREM-theta2EFGHIb

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → M
     233-244: Missing.

Note: Produced by alternative promoter usage. Activator.
Show »
Length:245
Mass (Da):26,513
Checksum:i244821D6A4AD32CD
GO
Isoform 6 (identifier: Q03060-8) [UniParc]FASTAAdd to basket
Also known as: CREM2alpha-a, IcergammaHIalpha, ICER1, ICERI

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: MTMETVESQH...FVPGSQVVVQ → MAVTGDDT
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative promoter usage. Repressor.Curated
Show »
Length:120
Mass (Da):13,435
Checksum:i723844391B15C4A8
GO
Isoform 7 (identifier: Q03060-9) [UniParc]FASTAAdd to basket
Also known as: CREM2alpha-b, IcerHIalpha, ICERIgamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MAVTGDDT
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing of isoform 6. Repressor.
Show »
Length:108
Mass (Da):12,124
Checksum:iBF84129AA7183E40
GO
Isoform 8 (identifier: Q03060-10) [UniParc]FASTAAdd to basket
Also known as: CREM 2beta-a, IcergammaHIbeta, ICERII

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: MTMETVESQH...FVPGSQVVVQ → MAVTGDDT

Note: Produced by alternative splicing of isoform 6. Repressor.Curated
Show »
Length:121
Mass (Da):13,486
Checksum:i6EFF7058EDE5FE79
GO
Isoform 9 (identifier: Q03060-11) [UniParc]FASTAAdd to basket
Also known as: CREM 2beta-b, IcerHIbeta, ICERIIgamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MAVTGDDT

Note: Produced by alternative splicing of isoform 6. Repressor.
Show »
Length:109
Mass (Da):12,175
Checksum:iE1B2CC0E4E59F383
GO
Isoform 10 (identifier: Q03060-12) [UniParc]FASTAAdd to basket
Also known as: CREMtheta1tau2beta, CREM-theta1EFGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → MWWHQHNLCFRRPIEEDYSSGDVEEK
     233-244: Missing.

Note: Produced by alternative promoter usage. Activator.
Show »
Length:270
Mass (Da):29,656
Checksum:i10A26E01D01D8FDC
GO
Isoform 11 (identifier: Q03060-13) [UniParc]FASTAAdd to basket
Also known as: CREM-theta1beta, CREM-theta1EFHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → MWWHQHNLCFRRPIEEDYSSGDVEEK
     170-232: Missing.
     245-245: A → T

Note: Produced by alternative splicing of isoform 10. Repressor.
Show »
Length:219
Mass (Da):24,774
Checksum:iB7AB068F482F3C29
GO
Isoform 12 (identifier: Q03060-14) [UniParc]FASTAAdd to basket
Also known as: CREM-theta2beta, CREM-theta2EFHIb, CREM-theta2-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → M
     170-232: Missing.
     245-245: A → T

Note: Produced by alternative splicing of isoform 5. Repressor.
Show »
Length:194
Mass (Da):21,630
Checksum:iFA038D9739438F76
GO
Isoform 13 (identifier: Q03060-15) [UniParc]FASTAAdd to basket
Also known as: CREM-BEFGgammaHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:312
Mass (Da):33,825
Checksum:i1C129B0200C8A1F7
GO
Isoform 14 (identifier: Q03060-16) [UniParc]FASTAAdd to basket
Also known as: CREM-tau2-gamma, CREM-BEFGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     233-244: Missing.

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:300
Mass (Da):32,514
Checksum:iC759C78AB56E0FC5
GO
Isoform 15 (identifier: Q03060-17) [UniParc]FASTAAdd to basket
Also known as: CREM-BGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-169: Missing.
     233-244: Missing.

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:221
Mass (Da):23,839
Checksum:i70AD0E7C1AD98BC2
GO
Isoform 16 (identifier: Q03060-19) [UniParc]FASTAAdd to basket
Also known as: CREM-deltaC-G, CREM-BgammaHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-232: Missing.

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:170
Mass (Da):18,927
Checksum:i112F9B233752BF64
GO
Isoform 17 (identifier: Q03060-20) [UniParc]FASTAAdd to basket
Also known as: CREM-BHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     170-244: Missing.

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:286
Mass (Da):31,405
Checksum:i7E0BD230608E9563
GO
Isoform 18 (identifier: Q03060-21) [UniParc]FASTAAdd to basket
Also known as: CREM-BHIalpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     170-244: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:285
Mass (Da):31,354
Checksum:iC69A2CB4707EDEB4
GO
Isoform 19 (identifier: Q03060-22) [UniParc]FASTAAdd to basket
Also known as: CREM-theta1tau2gamma, CREM-theta1EFGgammaHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → MWWHQHNLCFRRPIEEDYSSGDVEEK

Note: Produced by alternative splicing of isoform 10. Activator.
Show »
Length:282
Mass (Da):30,968
Checksum:i16CD469D964E1310
GO
Isoform 20 (identifier: Q03060-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-242: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,535
Checksum:i09B250970C67483E
GO
Isoform 21 (identifier: Q03060-24) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MNRTQELSGQLS
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,679
Checksum:i37EE6DBB1C791D37
GO
Isoform 22 (identifier: Q03060-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-90: Missing.
     170-186: IAIAQGGTIQISNPGSD → SMYAAIRYDTVLALSLL
     187-345: Missing.

Note: No experimental confirmation available.
Show »
Length:137
Mass (Da):14,871
Checksum:i0AC3C47664350D9F
GO
Isoform 23 (identifier: Q03060-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     170-233: IAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQD → N
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Show »
Length:248
Mass (Da):27,549
Checksum:i1419AC7C6E2D6FD9
GO
Isoform 24 (identifier: Q03060-27) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MNRTQELSGQLS

Note: Produced by alternative splicing.
Show »
Length:113
Mass (Da):12,730
Checksum:iA42AA6716FE292A0
GO
Isoform 25 (identifier: Q03060-28) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-195: Missing.
     233-244: Missing.

Note: Produced by alternative splicing.
Show »
Length:138
Mass (Da):15,116
Checksum:iAC08D42670DFA05C
GO
Isoform 26 (identifier: Q03060-29) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: MTMETVESQH...FVPGSQVVVQ → MNRTQELSGQLS

Note: Produced by alternative splicing.
Show »
Length:125
Mass (Da):14,041
Checksum:i848D9FD6E95B2AD1
GO
Isoform 27 (identifier: Q03060-30) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-90: Missing.
     170-245: IAIAQGGTIQ...TELAPSHMAA → T

Note: Produced by alternative splicing.
Show »
Length:221
Mass (Da):24,385
Checksum:i59881FC7317C817C
GO
Isoform 28 (identifier: Q03060-31) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     233-244: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing. No experimental confirmation available.
Show »
Length:299
Mass (Da):32,463
Checksum:i148F966190E4787C
GO
Isoform 29 (identifier: Q03060-32) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     170-245: IAIAQGGTIQ...TELAPSHMAA → T
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing. No experimental confirmation available.
Show »
Length:236
Mass (Da):26,269
Checksum:iDCBB6E2218E14D07
GO

Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PB41E9PB41_HUMAN
cAMP-responsive element modulator
CREM
96Annotation score:
J3KQC0J3KQC0_HUMAN
cAMP-responsive element modulator
CREM
345Annotation score:
E9PAR2E9PAR2_HUMAN
cAMP-responsive element modulator
CREM
95Annotation score:
G5E998G5E998_HUMAN
cAMP-responsive element modulator
CREM
269Annotation score:
J3KR46J3KR46_HUMAN
cAMP-responsive element modulator
CREM
219Annotation score:
C9K092C9K092_HUMAN
cAMP-responsive element modulator
CREM
193Annotation score:
A0A0A0MSU8A0A0A0MSU8_HUMAN
cAMP-responsive element modulator
CREM
156Annotation score:
C9IYM9C9IYM9_HUMAN
cAMP-responsive element modulator
CREM
186Annotation score:
C9J5A7C9J5A7_HUMAN
cAMP-responsive element modulator
CREM
78Annotation score:
H7C4X0H7C4X0_HUMAN
cAMP-responsive element modulator
CREM
53Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAB03751 differs from that shown. Reason: Erroneous termination at position 345. Translated as Tyr.Curated
The sequence AAF68266 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33N → I in AAC60616 (PubMed:1461747).Curated1
Sequence conflicti33N → I in AAC60617 (PubMed:1461747).Curated1
Sequence conflicti39A → R in CAA78858 (PubMed:7916662).Curated1
Sequence conflicti41 – 45VSVAG → CSELR in AAC60616 (PubMed:1461747).Curated5
Sequence conflicti41 – 45VSVAG → CSELR in AAC60617 (PubMed:1461747).Curated5
Sequence conflicti276H → R in BAA03562 (PubMed:8206879).Curated1
Sequence conflicti276H → R in BAA03564 (Ref. 4) Curated1
Sequence conflicti276H → R in BAA03565 (Ref. 4) Curated1
Sequence conflicti276H → R in BAA03566 (Ref. 4) Curated1
Sequence conflicti276H → R in BAA03567 (Ref. 4) Curated1
Isoform 6 (identifier: Q03060-8)
Sequence conflicti7D → E in AAC19383 (Ref. 4) Curated1
Sequence conflicti112K → R in AAC19383 (Ref. 4) Curated1
Isoform 8 (identifier: Q03060-10)
Sequence conflicti7D → E in AAB03751 (PubMed:8622971).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055561254Q → R1 PublicationCorresponds to variant dbSNP:rs1804604Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0596971 – 244MTMET…PSHMA → MNRTQELSGQLS in isoform 21 and isoform 24. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0596981 – 244MTMET…PSHMA → MAVTGDDT in isoform 7 and isoform 9. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0596991 – 242Missing in isoform 20. 1 PublicationAdd BLAST242
Alternative sequenceiVSP_0597001 – 232MTMET…QVVVQ → MNRTQELSGQLS in isoform 26. Add BLAST232
Alternative sequenceiVSP_0597011 – 232MTMET…QVVVQ → MAVTGDDT in isoform 6 and isoform 8. 3 PublicationsAdd BLAST232
Alternative sequenceiVSP_0597021 – 195Missing in isoform 25. Add BLAST195
Alternative sequenceiVSP_0597031 – 89MTMET…IHTVQ → MWWHQHNLCFRRPIEEDYSS GDVEEK in isoform 10, isoform 11 and isoform 19. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0597041 – 89MTMET…IHTVQ → M in isoform 5 and isoform 12. Add BLAST89
Alternative sequenceiVSP_0597051M → MSKCARKKYIKTNPRQM in isoform 2, isoform 3, isoform 4, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 23, isoform 28 and isoform 29. 3 Publications1
Alternative sequenceiVSP_05970642 – 232Missing in isoform 16. Add BLAST191
Alternative sequenceiVSP_05970742 – 169Missing in isoform 15. Add BLAST128
Alternative sequenceiVSP_05970842 – 90Missing in isoform 4, isoform 13, isoform 14, isoform 22, isoform 23, isoform 27, isoform 28 and isoform 29. 3 PublicationsAdd BLAST49
Alternative sequenceiVSP_059709170 – 245IAIAQ…SHMAA → T in isoform 4, isoform 27 and isoform 29. Add BLAST76
Alternative sequenceiVSP_059710170 – 244Missing in isoform 17 and isoform 18. Add BLAST75
Alternative sequenceiVSP_059711170 – 233IAIAQ…VVVQD → N in isoform 23. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_059712170 – 232Missing in isoform 11 and isoform 12. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_059713170 – 186IAIAQ…NPGSD → SMYAAIRYDTVLALSLL in isoform 22. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_059714187 – 345Missing in isoform 22. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_059715233 – 244Missing in isoform 2, isoform 3, isoform 5, isoform 10, isoform 14, isoform 15, isoform 25 and isoform 28. 5 PublicationsAdd BLAST12
Alternative sequenceiVSP_059716245A → T in isoform 12 and isoform 11. 1 Publication1
Alternative sequenceiVSP_059717301 – 345KECRR…PKTDY → RECRRKKKEYVKCLENRVAV LENQNKTLIEELKALKDLYC HKVE in isoform 3, isoform 6, isoform 7, isoform 18, isoform 20, isoform 21, isoform 23, isoform 28 and isoform 29. 4 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14825 mRNA Translation: BAA03562.1
D14826 mRNA Translation: BAA03564.1
D14826 mRNA Translation: BAA03565.1
D14826 mRNA Translation: BAA03566.1
D14826 mRNA Translation: BAA03567.1
U44836 mRNA Translation: AAB03751.1 Sequence problems.
AF069065 mRNA Translation: AAC19383.1
AY292864 mRNA Translation: AAP44115.1
AK289379 mRNA Translation: BAF82068.1
AK290612 mRNA Translation: BAF83301.1
AK291566 mRNA Translation: BAF84255.1
AK301906 mRNA Translation: BAG63333.1
AL117336 Genomic DNA No translation available.
AL157783 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85917.1
CH471072 Genomic DNA Translation: EAW85918.1
BC017117 mRNA Translation: AAH17117.1
BC066342 mRNA Translation: AAH66342.1
BC090051 mRNA Translation: AAH90051.1
AF213899
, AF212158, AF213897, AF213898 Genomic DNA Translation: AAF68266.2 Sequence problems.
AF417234 mRNA Translation: AAN32656.1
S68271 mRNA Translation: AAC60616.2
S68134 mRNA Translation: AAC60617.2
Z15159 mRNA Translation: CAA78858.1
AF217318, AF214665 Genomic DNA Translation: AAF66158.2
AF217318, AF214665 Genomic DNA Translation: AAF68682.1
CCDSiCCDS31181.1 [Q03060-32]
CCDS53517.1 [Q03060-10]
CCDS53518.1 [Q03060-9]
CCDS53519.1 [Q03060-11]
CCDS53520.1 [Q03060-27]
CCDS53521.1 [Q03060-23]
CCDS58074.1 [Q03060-22]
CCDS58075.1 [Q03060-28]
CCDS58076.1 [Q03060-29]
CCDS7180.1 [Q03060-16]
CCDS7181.1 [Q03060-31]
CCDS7182.1 [Q03060-26]
CCDS7183.1 [Q03060-30]
CCDS7184.1 [Q03060-25]
CCDS7185.1 [Q03060-12]
CCDS7186.1 [Q03060-7]
CCDS7187.1 [Q03060-8]
CCDS7188.1 [Q03060-24]
PIRiJC2087
JC6135
JX0307
S26685
RefSeqiNP_001254491.1, NM_001267562.1
NP_001254493.1, NM_001267564.1 [Q03060-22]
NP_001254496.1, NM_001267567.1 [Q03060-28]
NP_001254499.1, NM_001267570.1 [Q03060-29]
NP_001872.3, NM_001881.3 [Q03060-25]
NP_853549.1, NM_181571.2 [Q03060-16]
NP_874386.1, NM_182717.1 [Q03060-8]
NP_874387.1, NM_182718.1 [Q03060-11]
NP_874388.1, NM_182719.1 [Q03060-10]
NP_874389.1, NM_182720.1 [Q03060-9]
NP_874390.1, NM_182721.1 [Q03060-24]
NP_874392.1, NM_182723.1 [Q03060-23]
NP_874393.1, NM_182724.1 [Q03060-27]
NP_877570.1, NM_182769.2 [Q03060-7]
NP_877571.1, NM_182770.2
NP_877572.1, NM_182771.1 [Q03060-12]
NP_877573.1, NM_182772.1
NP_898829.1, NM_183011.1 [Q03060-31]
NP_898830.1, NM_183012.1 [Q03060-32]
NP_898831.1, NM_183013.2 [Q03060-26]
NP_898883.1, NM_183060.2 [Q03060-30]
XP_006717441.1, XM_006717378.3 [Q03060-16]
XP_006717442.1, XM_006717379.3 [Q03060-31]
XP_006717445.1, XM_006717382.3 [Q03060-2]
XP_006717446.1, XM_006717383.3 [Q03060-32]
XP_011517626.1, XM_011519324.2 [Q03060-15]
XP_011517627.1, XM_011519325.2 [Q03060-15]
XP_016871211.1, XM_017015722.1 [Q03060-30]
UniGeneiHs.200250

Genome annotation databases

EnsembliENST00000337656; ENSP00000337138; ENSG00000095794 [Q03060-31]
ENST00000342105; ENSP00000341875; ENSG00000095794 [Q03060-7]
ENST00000345491; ENSP00000265372; ENSG00000095794 [Q03060-16]
ENST00000348787; ENSP00000345384; ENSG00000095794 [Q03060-30]
ENST00000354759; ENSP00000346804; ENSG00000095794 [Q03060-26]
ENST00000356917; ENSP00000349387; ENSG00000095794 [Q03060-9]
ENST00000361599; ENSP00000354593; ENSG00000095794 [Q03060-12]
ENST00000374726; ENSP00000363858; ENSG00000095794 [Q03060-25]
ENST00000374728; ENSP00000363860; ENSG00000095794 [Q03060-30]
ENST00000374734; ENSP00000363866; ENSG00000095794 [Q03060-32]
ENST00000395887; ENSP00000379225; ENSG00000095794 [Q03060-22]
ENST00000429130; ENSP00000393538; ENSG00000095794 [Q03060-5]
ENST00000439705; ENSP00000409220; ENSG00000095794 [Q03060-26]
ENST00000463314; ENSP00000418336; ENSG00000095794 [Q03060-28]
ENST00000468236; ENSP00000419810; ENSG00000095794 [Q03060-29]
ENST00000473940; ENSP00000420681; ENSG00000095794 [Q03060-8]
ENST00000474931; ENSP00000417562; ENSG00000095794 [Q03060-24]
ENST00000479070; ENSP00000420511; ENSG00000095794 [Q03060-15]
ENST00000487763; ENSP00000417807; ENSG00000095794 [Q03060-10]
ENST00000488328; ENSP00000417460; ENSG00000095794 [Q03060-11]
ENST00000488741; ENSP00000419075; ENSG00000095794 [Q03060-23]
ENST00000489321; ENSP00000419924; ENSG00000095794 [Q03060-25]
ENST00000490511; ENSP00000417327; ENSG00000095794 [Q03060-27]
GeneIDi1390
KEGGihsa:1390
UCSCiuc001ixx.4 human [Q03060-5]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14825 mRNA Translation: BAA03562.1
D14826 mRNA Translation: BAA03564.1
D14826 mRNA Translation: BAA03565.1
D14826 mRNA Translation: BAA03566.1
D14826 mRNA Translation: BAA03567.1
U44836 mRNA Translation: AAB03751.1 Sequence problems.
AF069065 mRNA Translation: AAC19383.1
AY292864 mRNA Translation: AAP44115.1
AK289379 mRNA Translation: BAF82068.1
AK290612 mRNA Translation: BAF83301.1
AK291566 mRNA Translation: BAF84255.1
AK301906 mRNA Translation: BAG63333.1
AL117336 Genomic DNA No translation available.
AL157783 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85917.1
CH471072 Genomic DNA Translation: EAW85918.1
BC017117 mRNA Translation: AAH17117.1
BC066342 mRNA Translation: AAH66342.1
BC090051 mRNA Translation: AAH90051.1
AF213899
, AF212158, AF213897, AF213898 Genomic DNA Translation: AAF68266.2 Sequence problems.
AF417234 mRNA Translation: AAN32656.1
S68271 mRNA Translation: AAC60616.2
S68134 mRNA Translation: AAC60617.2
Z15159 mRNA Translation: CAA78858.1
AF217318, AF214665 Genomic DNA Translation: AAF66158.2
AF217318, AF214665 Genomic DNA Translation: AAF68682.1
CCDSiCCDS31181.1 [Q03060-32]
CCDS53517.1 [Q03060-10]
CCDS53518.1 [Q03060-9]
CCDS53519.1 [Q03060-11]
CCDS53520.1 [Q03060-27]
CCDS53521.1 [Q03060-23]
CCDS58074.1 [Q03060-22]
CCDS58075.1 [Q03060-28]
CCDS58076.1 [Q03060-29]
CCDS7180.1 [Q03060-16]
CCDS7181.1 [Q03060-31]
CCDS7182.1 [Q03060-26]
CCDS7183.1 [Q03060-30]
CCDS7184.1 [Q03060-25]
CCDS7185.1 [Q03060-12]
CCDS7186.1 [Q03060-7]
CCDS7187.1 [Q03060-8]
CCDS7188.1 [Q03060-24]
PIRiJC2087
JC6135
JX0307
S26685
RefSeqiNP_001254491.1, NM_001267562.1
NP_001254493.1, NM_001267564.1 [Q03060-22]
NP_001254496.1, NM_001267567.1 [Q03060-28]
NP_001254499.1, NM_001267570.1 [Q03060-29]
NP_001872.3, NM_001881.3 [Q03060-25]
NP_853549.1, NM_181571.2 [Q03060-16]
NP_874386.1, NM_182717.1 [Q03060-8]
NP_874387.1, NM_182718.1 [Q03060-11]
NP_874388.1, NM_182719.1 [Q03060-10]
NP_874389.1, NM_182720.1 [Q03060-9]
NP_874390.1, NM_182721.1 [Q03060-24]
NP_874392.1, NM_182723.1 [Q03060-23]
NP_874393.1, NM_182724.1 [Q03060-27]
NP_877570.1, NM_182769.2 [Q03060-7]
NP_877571.1, NM_182770.2
NP_877572.1, NM_182771.1 [Q03060-12]
NP_877573.1, NM_182772.1
NP_898829.1, NM_183011.1 [Q03060-31]
NP_898830.1, NM_183012.1 [Q03060-32]
NP_898831.1, NM_183013.2 [Q03060-26]
NP_898883.1, NM_183060.2 [Q03060-30]
XP_006717441.1, XM_006717378.3 [Q03060-16]
XP_006717442.1, XM_006717379.3 [Q03060-31]
XP_006717445.1, XM_006717382.3 [Q03060-2]
XP_006717446.1, XM_006717383.3 [Q03060-32]
XP_011517626.1, XM_011519324.2 [Q03060-15]
XP_011517627.1, XM_011519325.2 [Q03060-15]
XP_016871211.1, XM_017015722.1 [Q03060-30]
UniGeneiHs.200250

3D structure databases

ProteinModelPortaliQ03060
SMRiQ03060
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107780, 26 interactors
IntActiQ03060, 28 interactors
MINTiQ03060

PTM databases

iPTMnetiQ03060
PhosphoSitePlusiQ03060

Polymorphism and mutation databases

BioMutaiCREM
DMDMi259016392

Proteomic databases

MaxQBiQ03060
PeptideAtlasiQ03060
PRIDEiQ03060
ProteomicsDBi58163
58164 [Q03060-1]
58165 [Q03060-10]
58166 [Q03060-11]
58167 [Q03060-12]
58168 [Q03060-13]
58169 [Q03060-14]
58170 [Q03060-15]
58171 [Q03060-16]
58172 [Q03060-17]
58173 [Q03060-19]
58174 [Q03060-2]
58175 [Q03060-20]
58176 [Q03060-21]
58177 [Q03060-22]
58178 [Q03060-23]
58179 [Q03060-24]
58180 [Q03060-25]
58181 [Q03060-6]
58182 [Q03060-7]
58183 [Q03060-8]
58184 [Q03060-9]

Protocols and materials databases

DNASUi1390
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337656; ENSP00000337138; ENSG00000095794 [Q03060-31]
ENST00000342105; ENSP00000341875; ENSG00000095794 [Q03060-7]
ENST00000345491; ENSP00000265372; ENSG00000095794 [Q03060-16]
ENST00000348787; ENSP00000345384; ENSG00000095794 [Q03060-30]
ENST00000354759; ENSP00000346804; ENSG00000095794 [Q03060-26]
ENST00000356917; ENSP00000349387; ENSG00000095794 [Q03060-9]
ENST00000361599; ENSP00000354593; ENSG00000095794 [Q03060-12]
ENST00000374726; ENSP00000363858; ENSG00000095794 [Q03060-25]
ENST00000374728; ENSP00000363860; ENSG00000095794 [Q03060-30]
ENST00000374734; ENSP00000363866; ENSG00000095794 [Q03060-32]
ENST00000395887; ENSP00000379225; ENSG00000095794 [Q03060-22]
ENST00000429130; ENSP00000393538; ENSG00000095794 [Q03060-5]
ENST00000439705; ENSP00000409220; ENSG00000095794 [Q03060-26]
ENST00000463314; ENSP00000418336; ENSG00000095794 [Q03060-28]
ENST00000468236; ENSP00000419810; ENSG00000095794 [Q03060-29]
ENST00000473940; ENSP00000420681; ENSG00000095794 [Q03060-8]
ENST00000474931; ENSP00000417562; ENSG00000095794 [Q03060-24]
ENST00000479070; ENSP00000420511; ENSG00000095794 [Q03060-15]
ENST00000487763; ENSP00000417807; ENSG00000095794 [Q03060-10]
ENST00000488328; ENSP00000417460; ENSG00000095794 [Q03060-11]
ENST00000488741; ENSP00000419075; ENSG00000095794 [Q03060-23]
ENST00000489321; ENSP00000419924; ENSG00000095794 [Q03060-25]
ENST00000490511; ENSP00000417327; ENSG00000095794 [Q03060-27]
GeneIDi1390
KEGGihsa:1390
UCSCiuc001ixx.4 human [Q03060-5]

Organism-specific databases

CTDi1390
DisGeNETi1390
EuPathDBiHostDB:ENSG00000095794.19
GeneCardsiCREM
HGNCiHGNC:2352 CREM
HPAiCAB018352
HPA001818
MIMi123812 gene
neXtProtiNX_Q03060
OpenTargetsiENSG00000095794
PharmGKBiPA26871
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000008655
HOGENOMiHOG000007365
HOVERGENiHBG011077
InParanoidiQ03060
KOiK09052
PhylomeDBiQ03060
TreeFamiTF106464

Enzyme and pathway databases

ReactomeiR-HSA-400253 Circadian Clock
SignaLinkiQ03060
SIGNORiQ03060

Miscellaneous databases

ChiTaRSiCREM human
GeneWikiiCAMP_responsive_element_modulator
GenomeRNAii1390
PROiPR:Q03060
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000095794 Expressed in 219 organ(s), highest expression level in right testis
ExpressionAtlasiQ03060 baseline and differential
GenevisibleiQ03060 HS

Family and domain databases

InterProiView protein in InterPro
IPR004827 bZIP
IPR003102 Coactivator_CBP_pKID
IPR001630 Leuzip_CREB
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PF02173 pKID, 1 hit
PRINTSiPR00041 LEUZIPPRCREB
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit
PS50953 KID, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCREM_HUMAN
AccessioniPrimary (citable) accession number: Q03060
Secondary accession number(s): A8K014
, A8K3J7, A8K6A1, A8MPQ2, B4DXC1, C9J785, C9JZ10, E9PAR4, E9PHM1, O75519, Q14501, Q14503, Q14504, Q14505, Q14506, Q15731, Q16114, Q16116, Q5T9H7, Q5W1A6, Q5W1A7, Q5W1A8, Q5W1A9, Q5W1B0, Q5W1B2, Q7Z2Q6, Q8IVD4, Q96AG7, Q9NZ98, Q9NZ99, Q9NZB9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: September 12, 2018
Last modified: October 10, 2018
This is version 186 of the entry and version 6 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again