Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q03060 (CREM_HUMAN)

Entry version 191 (08 May 2019)
Sequence version 6 (12 Sep 2018)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

cAMP-responsive element modulator

Gene

CREM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in spermatid maturation (PubMed:10373550).1 Publication
Isoform 6: May play a role in the regulation of the circadian clock: acts as a transcriptional repressor of the core circadian component PER1 by directly binding to cAMP response elements in its promoter.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding, Repressor
Biological processBiological rhythms, Differentiation, Spermatogenesis, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-400253 Circadian Clock

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q03060

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q03060

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-responsive element modulatorCurated
Alternative name(s):
Inducible cAMP early repressor
Short name:
ICER
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CREMImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:2352 CREM

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		123812 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q03060

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		1390

Open Targets

More...OpenTargetsi		ENSG00000095794

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26871

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CREM

Domain mapping of disease mutations (DMDM)

More...DMDMi		259016392

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000766071 – 345cAMP-responsive element modulatorAdd BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei102PhosphoserineBy similarity1
Modified residuei129PhosphoserineCombined sources1
Modified residuei271PhosphoserineCombined sources1
Modified residuei274PhosphoserineCombined sources1
Modified residuei277PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 9 is ubiquitinated by CDC34 and RAD6B in order to be degraded by the proteasome.1 Publication
Stimulated by phosphorylation. Phosphorylated on Ser-116 by TSSK4 in vitro.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q03060

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q03060

PeptideAtlas

More...PeptideAtlasi		Q03060

PRoteomics IDEntifications database

More...PRIDEi		Q03060

ProteomicsDB human proteome resource

More...ProteomicsDBi		58163
58164 [Q03060-1]
58165 [Q03060-10]
58166 [Q03060-11]
58167 [Q03060-12]
58168 [Q03060-13]
58169 [Q03060-14]
58170 [Q03060-15]
58171 [Q03060-16]
58172 [Q03060-17]
58173 [Q03060-19]
58174 [Q03060-2]
58175 [Q03060-20]
58176 [Q03060-21]
58177 [Q03060-22]
58178 [Q03060-23]
58179 [Q03060-24]
58180 [Q03060-25]
58181 [Q03060-6]
58182 [Q03060-7]
58183 [Q03060-8]
58184 [Q03060-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q03060

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q03060

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000095794 Expressed in 219 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q03060 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q03060 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB018352
HPA001818

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a dimer.

Interacts with FHL5 (By similarity).

Interacts with CDC34 (PubMed:10373550). May interact with TSSK4 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107780, 26 interactors

Protein interaction database and analysis system

More...IntActi		Q03060, 28 interactors

Molecular INTeraction database

More...MINTi		Q03060

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q03060

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini88 – 147KIDPROSITE-ProRule annotationAdd BLAST60
Domaini286 – 345bZIPPROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni287 – 312Basic motifPROSITE-ProRule annotationAdd BLAST26
Regioni314 – 335Leucine-zipperPROSITE-ProRule annotationAdd BLAST22

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156952

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000007365

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q03060

KEGG Orthology (KO)

More...KOi		K09052

Identification of Orthologs from Complete Genome Data

More...OMAi		ESAHMQT

Database of Orthologous Groups

More...OrthoDBi		957343at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q03060

TreeFam database of animal gene trees

More...TreeFami		TF106464

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004827 bZIP
IPR003102 Coactivator_CBP_pKID
IPR001630 Leuzip_CREB

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00170 bZIP_1, 1 hit
PF02173 pKID, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00041 LEUZIPPRCREB

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00338 BRLZ, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit
PS50953 KID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (29+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 29 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 29 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q03060-5) [UniParc]FASTAAdd to basket
Also known as: CREM-BCEFGgammaHIbeta

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTMETVESQH DGSITASLTE SKSAHVQTQT GQNSIPALAQ VSVAGSGTRR 
        60         70         80         90        100
GSPAVTLVQL PSGQTIHVQG VIQTPQPWVI QSSEIHTVQV AAIAETDESA 
       110        120        130        140        150
ESEGVIDSHK RREILSRRPS YRKILNELSS DVPGVPKIEE ERSEEEGTPP 
       160        170        180        190        200
SIATMAVPTS IYQTSTGQYI AIAQGGTIQI SNPGSDGVQG LQALTMTNSG 
       210        220        230        240        250
APPPGATIVQ YAAQSADGTQ QFFVPGSQVV VQDEETELAP SHMAAATGDM 
       260        270        280        290        300
PTYQIRAPTA ALPQGVVMAA SPGSLHSPQQ LAEEATRKRE LRLMKNREAA 
       310        320        330        340 
KECRRRKKEY VKCLESRVAV LEVQNKKLIE ELETLKDICS PKTDY
Note: Produced by alternative promoter usage.
Length:345
Mass (Da):37,006
Last modified:September 12, 2018 - v6
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4DDEE62904CDD0E6
GO
Isoform 2 (identifier: Q03060-1) [UniParc]FASTAAdd to basket
Also known as: Beta, CREM-BCEFGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     233-244: Missing.

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:349
Mass (Da):37,628
Checksum:iF6B8D2BF073C00C0
GO
Isoform 3 (identifier: Q03060-6) [UniParc]FASTAAdd to basket
Also known as: CREM-BCEFGIalpha, Tau

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     233-244: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:348
Mass (Da):37,577
Checksum:i859AA3D3C2EB7D59
GO
Isoform 4 (identifier: Q03060-2) [UniParc]FASTAAdd to basket
Also known as: Alpha, CREM-BEFHIb, CREM-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     170-245: IAIAQGGTIQ...TELAPSHMAA → T

Note: Produced by alternative splicing of isoform 1.
Show »
Length:237
Mass (Da):26,320
Checksum:i89C1F372F6E60AF0
GO
Isoform 5 (identifier: Q03060-7) [UniParc]FASTAAdd to basket
Also known as: CREM-theta2tau-gamma, CREM-theta2EFGHIb

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → M
     233-244: Missing.

Note: Produced by alternative promoter usage. Activator.
Show »
Length:245
Mass (Da):26,513
Checksum:i244821D6A4AD32CD
GO
Isoform 6 (identifier: Q03060-8) [UniParc]FASTAAdd to basket
Also known as: CREM2alpha-a, IcergammaHIalpha, ICER1, ICERI

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: MTMETVESQH...FVPGSQVVVQ → MAVTGDDT
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative promoter usage. Repressor.Curated
Show »
Length:120
Mass (Da):13,435
Checksum:i723844391B15C4A8
GO
Isoform 7 (identifier: Q03060-9) [UniParc]FASTAAdd to basket
Also known as: CREM2alpha-b, IcerHIalpha, ICERIgamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MAVTGDDT
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing of isoform 6. Repressor.
Show »
Length:108
Mass (Da):12,124
Checksum:iBF84129AA7183E40
GO
Isoform 8 (identifier: Q03060-10) [UniParc]FASTAAdd to basket
Also known as: CREM 2beta-a, IcergammaHIbeta, ICERII

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: MTMETVESQH...FVPGSQVVVQ → MAVTGDDT

Note: Produced by alternative splicing of isoform 6. Repressor.Curated
Show »
Length:121
Mass (Da):13,486
Checksum:i6EFF7058EDE5FE79
GO
Isoform 9 (identifier: Q03060-11) [UniParc]FASTAAdd to basket
Also known as: CREM 2beta-b, IcerHIbeta, ICERIIgamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MAVTGDDT

Note: Produced by alternative splicing of isoform 6. Repressor.
Show »
Length:109
Mass (Da):12,175
Checksum:iE1B2CC0E4E59F383
GO
Isoform 10 (identifier: Q03060-12) [UniParc]FASTAAdd to basket
Also known as: CREMtheta1tau2beta, CREM-theta1EFGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → MWWHQHNLCFRRPIEEDYSSGDVEEK
     233-244: Missing.

Note: Produced by alternative promoter usage. Activator.
Show »
Length:270
Mass (Da):29,656
Checksum:i10A26E01D01D8FDC
GO
Isoform 11 (identifier: Q03060-13) [UniParc]FASTAAdd to basket
Also known as: CREM-theta1beta, CREM-theta1EFHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → MWWHQHNLCFRRPIEEDYSSGDVEEK
     170-232: Missing.
     245-245: A → T

Note: Produced by alternative splicing of isoform 10. Repressor.
Show »
Length:219
Mass (Da):24,774
Checksum:iB7AB068F482F3C29
GO
Isoform 12 (identifier: Q03060-14) [UniParc]FASTAAdd to basket
Also known as: CREM-theta2beta, CREM-theta2EFHIb, CREM-theta2-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → M
     170-232: Missing.
     245-245: A → T

Note: Produced by alternative splicing of isoform 5. Repressor.
Show »
Length:194
Mass (Da):21,630
Checksum:iFA038D9739438F76
GO
Isoform 13 (identifier: Q03060-15) [UniParc]FASTAAdd to basket
Also known as: CREM-BEFGgammaHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:312
Mass (Da):33,825
Checksum:i1C129B0200C8A1F7
GO
Isoform 14 (identifier: Q03060-16) [UniParc]FASTAAdd to basket
Also known as: CREM-tau2-gamma, CREM-BEFGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     233-244: Missing.

Note: Produced by alternative splicing of isoform 1. Activator.
Show »
Length:300
Mass (Da):32,514
Checksum:iC759C78AB56E0FC5
GO
Isoform 15 (identifier: Q03060-17) [UniParc]FASTAAdd to basket
Also known as: CREM-BGHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-169: Missing.
     233-244: Missing.

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:221
Mass (Da):23,839
Checksum:i70AD0E7C1AD98BC2
GO
Isoform 16 (identifier: Q03060-19) [UniParc]FASTAAdd to basket
Also known as: CREM-deltaC-G, CREM-BgammaHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-232: Missing.

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:170
Mass (Da):18,927
Checksum:i112F9B233752BF64
GO
Isoform 17 (identifier: Q03060-20) [UniParc]FASTAAdd to basket
Also known as: CREM-BHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     170-244: Missing.

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:286
Mass (Da):31,405
Checksum:i7E0BD230608E9563
GO
Isoform 18 (identifier: Q03060-21) [UniParc]FASTAAdd to basket
Also known as: CREM-BHIalpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     170-244: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing of isoform 1. Repressor.
Show »
Length:285
Mass (Da):31,354
Checksum:iC69A2CB4707EDEB4
GO
Isoform 19 (identifier: Q03060-22) [UniParc]FASTAAdd to basket
Also known as: CREM-theta1tau2gamma, CREM-theta1EFGgammaHIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MTMETVESQH...IQSSEIHTVQ → MWWHQHNLCFRRPIEEDYSSGDVEEK

Note: Produced by alternative splicing of isoform 10. Activator.
Show »
Length:282
Mass (Da):30,968
Checksum:i16CD469D964E1310
GO
Isoform 20 (identifier: Q03060-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-242: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,535
Checksum:i09B250970C67483E
GO
Isoform 21 (identifier: Q03060-24) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MNRTQELSGQLS
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,679
Checksum:i37EE6DBB1C791D37
GO
Isoform 22 (identifier: Q03060-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-90: Missing.
     170-186: IAIAQGGTIQISNPGSD → SMYAAIRYDTVLALSLL
     187-345: Missing.

Note: No experimental confirmation available.
Show »
Length:137
Mass (Da):14,871
Checksum:i0AC3C47664350D9F
GO
Isoform 23 (identifier: Q03060-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     170-233: IAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQD → N
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Show »
Length:248
Mass (Da):27,549
Checksum:i1419AC7C6E2D6FD9
GO
Isoform 24 (identifier: Q03060-27) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: MTMETVESQH...ETELAPSHMA → MNRTQELSGQLS

Note: Produced by alternative splicing.
Show »
Length:113
Mass (Da):12,730
Checksum:iA42AA6716FE292A0
GO
Isoform 25 (identifier: Q03060-28) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-195: Missing.
     233-244: Missing.

Note: Produced by alternative splicing.
Show »
Length:138
Mass (Da):15,116
Checksum:iAC08D42670DFA05C
GO
Isoform 26 (identifier: Q03060-29) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: MTMETVESQH...FVPGSQVVVQ → MNRTQELSGQLS

Note: Produced by alternative splicing.
Show »
Length:125
Mass (Da):14,041
Checksum:i848D9FD6E95B2AD1
GO
Isoform 27 (identifier: Q03060-30) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-90: Missing.
     170-245: IAIAQGGTIQ...TELAPSHMAA → T

Note: Produced by alternative splicing.
Show »
Length:221
Mass (Da):24,385
Checksum:i59881FC7317C817C
GO
Isoform 28 (identifier: Q03060-31) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     233-244: Missing.
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing. No experimental confirmation available.
Show »
Length:299
Mass (Da):32,463
Checksum:i148F966190E4787C
GO
Isoform 29 (identifier: Q03060-32) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKCARKKYIKTNPRQM
     42-90: Missing.
     170-245: IAIAQGGTIQ...TELAPSHMAA → T
     301-345: KECRRRKKEY...KDICSPKTDY → RECRRKKKEY...LKDLYCHKVE

Note: Produced by alternative splicing. No experimental confirmation available.
Show »
Length:236
Mass (Da):26,269
Checksum:iDCBB6E2218E14D07
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9K092C9K092_HUMAN
cAMP-responsive element modulator
CREM
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSU8A0A0A0MSU8_HUMAN
cAMP-responsive element modulator
CREM
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PB41E9PB41_HUMAN
cAMP-responsive element modulator
CREM
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KR46J3KR46_HUMAN
cAMP-responsive element modulator
CREM
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E998G5E998_HUMAN
cAMP-responsive element modulator
CREM
269Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PAR2E9PAR2_HUMAN
cAMP-responsive element modulator
CREM
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KQC0J3KQC0_HUMAN
cAMP-responsive element modulator
CREM
345Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IYM9C9IYM9_HUMAN
cAMP-responsive element modulator
CREM
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WB03F8WB03_HUMAN
cAMP-responsive element modulator
CREM
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDF2F8WDF2_HUMAN
cAMP-responsive element modulator
CREM
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB03751 differs from that shown. Reason: Erroneous termination at position 345. Translated as Tyr.Curated
The sequence AAF68266 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti33N → I in AAC60616 (PubMed:1461747).Curated1
Sequence conflicti33N → I in AAC60617 (PubMed:1461747).Curated1
Sequence conflicti39A → R in CAA78858 (PubMed:7916662).Curated1
Sequence conflicti41 – 45VSVAG → CSELR in AAC60616 (PubMed:1461747).Curated5
Sequence conflicti41 – 45VSVAG → CSELR in AAC60617 (PubMed:1461747).Curated5
Sequence conflicti276H → R in BAA03562 (PubMed:8206879).Curated1
Sequence conflicti276H → R in BAA03564 (Ref. 4) Curated1
Sequence conflicti276H → R in BAA03565 (Ref. 4) Curated1
Sequence conflicti276H → R in BAA03566 (Ref. 4) Curated1
Sequence conflicti276H → R in BAA03567 (Ref. 4) Curated1
Isoform 6 (identifier: Q03060-8)
Sequence conflicti7D → E in AAC19383 (Ref. 4) Curated1
Sequence conflicti112K → R in AAC19383 (Ref. 4) Curated1
Isoform 8 (identifier: Q03060-10)
Sequence conflicti7D → E in AAB03751 (PubMed:8622971).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055561254Q → R1 PublicationCorresponds to variant dbSNP:rs1804604Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0596971 – 244MTMET…PSHMA → MNRTQELSGQLS in isoform 21 and isoform 24. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0596981 – 244MTMET…PSHMA → MAVTGDDT in isoform 7 and isoform 9. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0596991 – 242Missing in isoform 20. 1 PublicationAdd BLAST242
Alternative sequenceiVSP_0597001 – 232MTMET…QVVVQ → MNRTQELSGQLS in isoform 26. Add BLAST232
Alternative sequenceiVSP_0597011 – 232MTMET…QVVVQ → MAVTGDDT in isoform 6 and isoform 8. 3 PublicationsAdd BLAST232
Alternative sequenceiVSP_0597021 – 195Missing in isoform 25. Add BLAST195
Alternative sequenceiVSP_0597031 – 89MTMET…IHTVQ → MWWHQHNLCFRRPIEEDYSS GDVEEK in isoform 10, isoform 11 and isoform 19. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0597041 – 89MTMET…IHTVQ → M in isoform 5 and isoform 12. Add BLAST89
Alternative sequenceiVSP_0597051M → MSKCARKKYIKTNPRQM in isoform 2, isoform 3, isoform 4, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 23, isoform 28 and isoform 29. 3 Publications1
Alternative sequenceiVSP_05970642 – 232Missing in isoform 16. Add BLAST191
Alternative sequenceiVSP_05970742 – 169Missing in isoform 15. Add BLAST128
Alternative sequenceiVSP_05970842 – 90Missing in isoform 4, isoform 13, isoform 14, isoform 22, isoform 23, isoform 27, isoform 28 and isoform 29. 3 PublicationsAdd BLAST49
Alternative sequenceiVSP_059709170 – 245IAIAQ…SHMAA → T in isoform 4, isoform 27 and isoform 29. Add BLAST76
Alternative sequenceiVSP_059710170 – 244Missing in isoform 17 and isoform 18. Add BLAST75
Alternative sequenceiVSP_059711170 – 233IAIAQ…VVVQD → N in isoform 23. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_059712170 – 232Missing in isoform 11 and isoform 12. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_059713170 – 186IAIAQ…NPGSD → SMYAAIRYDTVLALSLL in isoform 22. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_059714187 – 345Missing in isoform 22. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_059715233 – 244Missing in isoform 2, isoform 3, isoform 5, isoform 10, isoform 14, isoform 15, isoform 25 and isoform 28. 5 PublicationsAdd BLAST12
Alternative sequenceiVSP_059716245A → T in isoform 12 and isoform 11. 1 Publication1
Alternative sequenceiVSP_059717301 – 345KECRR…PKTDY → RECRRKKKEYVKCLENRVAV LENQNKTLIEELKALKDLYC HKVE in isoform 3, isoform 6, isoform 7, isoform 18, isoform 20, isoform 21, isoform 23, isoform 28 and isoform 29. 4 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D14825 mRNA Translation: BAA03562.1
D14826 mRNA Translation: BAA03564.1
D14826 mRNA Translation: BAA03565.1
D14826 mRNA Translation: BAA03566.1
D14826 mRNA Translation: BAA03567.1
U44836 mRNA Translation: AAB03751.1 Sequence problems.
AF069065 mRNA Translation: AAC19383.1
AY292864 mRNA Translation: AAP44115.1
AK289379 mRNA Translation: BAF82068.1
AK290612 mRNA Translation: BAF83301.1
AK291566 mRNA Translation: BAF84255.1
AK301906 mRNA Translation: BAG63333.1
AL117336 Genomic DNA No translation available.
AL157783 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85917.1
CH471072 Genomic DNA Translation: EAW85918.1
BC017117 mRNA Translation: AAH17117.1
BC066342 mRNA Translation: AAH66342.1
BC090051 mRNA Translation: AAH90051.1
AF213899
, AF212158, AF213897, AF213898 Genomic DNA Translation: AAF68266.2 Sequence problems.
AF417234 mRNA Translation: AAN32656.1
S68271 mRNA Translation: AAC60616.2
S68134 mRNA Translation: AAC60617.2
Z15159 mRNA Translation: CAA78858.1
AF217318, AF214665 Genomic DNA Translation: AAF66158.2
AF217318, AF214665 Genomic DNA Translation: AAF68682.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31181.1 [Q03060-32]
CCDS53517.1 [Q03060-10]
CCDS53518.1 [Q03060-9]
CCDS53519.1 [Q03060-11]
CCDS53520.1 [Q03060-27]
CCDS53521.1 [Q03060-23]
CCDS58074.1 [Q03060-22]
CCDS58075.1 [Q03060-28]
CCDS58076.1 [Q03060-29]
CCDS7180.1 [Q03060-16]
CCDS7181.1 [Q03060-31]
CCDS7182.1 [Q03060-26]
CCDS7183.1 [Q03060-30]
CCDS7184.1 [Q03060-25]
CCDS7185.1 [Q03060-12]
CCDS7186.1 [Q03060-7]
CCDS7187.1 [Q03060-8]
CCDS7188.1 [Q03060-24]

Protein sequence database of the Protein Information Resource

More...PIRi		JC2087
JC6135
JX0307
S26685

NCBI Reference Sequences

More...RefSeqi		NP_001254491.1, NM_001267562.1
NP_001254493.1, NM_001267564.1 [Q03060-22]
NP_001254496.1, NM_001267567.1 [Q03060-28]
NP_001254499.1, NM_001267570.1 [Q03060-29]
NP_001872.3, NM_001881.3 [Q03060-25]
NP_853549.1, NM_181571.2 [Q03060-16]
NP_874386.1, NM_182717.1 [Q03060-8]
NP_874387.1, NM_182718.1 [Q03060-11]
NP_874388.1, NM_182719.1 [Q03060-10]
NP_874389.1, NM_182720.1 [Q03060-9]
NP_874390.1, NM_182721.1 [Q03060-24]
NP_874392.1, NM_182723.1 [Q03060-23]
NP_874393.1, NM_182724.1 [Q03060-27]
NP_877570.1, NM_182769.2 [Q03060-7]
NP_877571.1, NM_182770.2
NP_877572.1, NM_182771.1 [Q03060-12]
NP_877573.1, NM_182772.1
NP_898829.1, NM_183011.1 [Q03060-31]
NP_898830.1, NM_183012.1 [Q03060-32]
NP_898831.1, NM_183013.2 [Q03060-26]
NP_898883.1, NM_183060.2 [Q03060-30]
XP_006717441.1, XM_006717378.3 [Q03060-16]
XP_006717442.1, XM_006717379.3 [Q03060-31]
XP_006717445.1, XM_006717382.3 [Q03060-2]
XP_006717446.1, XM_006717383.3 [Q03060-32]
XP_011517626.1, XM_011519324.2 [Q03060-15]
XP_011517627.1, XM_011519325.2 [Q03060-15]
XP_016871211.1, XM_017015722.1 [Q03060-30]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000337656; ENSP00000337138; ENSG00000095794 [Q03060-31]
ENST00000342105; ENSP00000341875; ENSG00000095794 [Q03060-7]
ENST00000345491; ENSP00000265372; ENSG00000095794 [Q03060-16]
ENST00000348787; ENSP00000345384; ENSG00000095794 [Q03060-30]
ENST00000354759; ENSP00000346804; ENSG00000095794 [Q03060-26]
ENST00000356917; ENSP00000349387; ENSG00000095794 [Q03060-9]
ENST00000361599; ENSP00000354593; ENSG00000095794 [Q03060-12]
ENST00000374726; ENSP00000363858; ENSG00000095794 [Q03060-25]
ENST00000374728; ENSP00000363860; ENSG00000095794 [Q03060-30]
ENST00000374734; ENSP00000363866; ENSG00000095794 [Q03060-32]
ENST00000395887; ENSP00000379225; ENSG00000095794 [Q03060-22]
ENST00000429130; ENSP00000393538; ENSG00000095794 [Q03060-5]
ENST00000439705; ENSP00000409220; ENSG00000095794 [Q03060-26]
ENST00000463314; ENSP00000418336; ENSG00000095794 [Q03060-28]
ENST00000468236; ENSP00000419810; ENSG00000095794 [Q03060-29]
ENST00000473940; ENSP00000420681; ENSG00000095794 [Q03060-8]
ENST00000474931; ENSP00000417562; ENSG00000095794 [Q03060-24]
ENST00000479070; ENSP00000420511; ENSG00000095794 [Q03060-15]
ENST00000487763; ENSP00000417807; ENSG00000095794 [Q03060-10]
ENST00000488328; ENSP00000417460; ENSG00000095794 [Q03060-11]
ENST00000488741; ENSP00000419075; ENSG00000095794 [Q03060-23]
ENST00000489321; ENSP00000419924; ENSG00000095794 [Q03060-25]
ENST00000490511; ENSP00000417327; ENSG00000095794 [Q03060-27]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1390

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1390

UCSC genome browser

More...UCSCi		uc001ixx.4 human [Q03060-5]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14825 mRNA Translation: BAA03562.1
D14826 mRNA Translation: BAA03564.1
D14826 mRNA Translation: BAA03565.1
D14826 mRNA Translation: BAA03566.1
D14826 mRNA Translation: BAA03567.1
U44836 mRNA Translation: AAB03751.1 Sequence problems.
AF069065 mRNA Translation: AAC19383.1
AY292864 mRNA Translation: AAP44115.1
AK289379 mRNA Translation: BAF82068.1
AK290612 mRNA Translation: BAF83301.1
AK291566 mRNA Translation: BAF84255.1
AK301906 mRNA Translation: BAG63333.1
AL117336 Genomic DNA No translation available.
AL157783 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85917.1
CH471072 Genomic DNA Translation: EAW85918.1
BC017117 mRNA Translation: AAH17117.1
BC066342 mRNA Translation: AAH66342.1
BC090051 mRNA Translation: AAH90051.1
AF213899
, AF212158, AF213897, AF213898 Genomic DNA Translation: AAF68266.2 Sequence problems.
AF417234 mRNA Translation: AAN32656.1
S68271 mRNA Translation: AAC60616.2
S68134 mRNA Translation: AAC60617.2
Z15159 mRNA Translation: CAA78858.1
AF217318, AF214665 Genomic DNA Translation: AAF66158.2
AF217318, AF214665 Genomic DNA Translation: AAF68682.1
CCDSiCCDS31181.1 [Q03060-32]
CCDS53517.1 [Q03060-10]
CCDS53518.1 [Q03060-9]
CCDS53519.1 [Q03060-11]
CCDS53520.1 [Q03060-27]
CCDS53521.1 [Q03060-23]
CCDS58074.1 [Q03060-22]
CCDS58075.1 [Q03060-28]
CCDS58076.1 [Q03060-29]
CCDS7180.1 [Q03060-16]
CCDS7181.1 [Q03060-31]
CCDS7182.1 [Q03060-26]
CCDS7183.1 [Q03060-30]
CCDS7184.1 [Q03060-25]
CCDS7185.1 [Q03060-12]
CCDS7186.1 [Q03060-7]
CCDS7187.1 [Q03060-8]
CCDS7188.1 [Q03060-24]
PIRiJC2087
JC6135
JX0307
S26685
RefSeqiNP_001254491.1, NM_001267562.1
NP_001254493.1, NM_001267564.1 [Q03060-22]
NP_001254496.1, NM_001267567.1 [Q03060-28]
NP_001254499.1, NM_001267570.1 [Q03060-29]
NP_001872.3, NM_001881.3 [Q03060-25]
NP_853549.1, NM_181571.2 [Q03060-16]
NP_874386.1, NM_182717.1 [Q03060-8]
NP_874387.1, NM_182718.1 [Q03060-11]
NP_874388.1, NM_182719.1 [Q03060-10]
NP_874389.1, NM_182720.1 [Q03060-9]
NP_874390.1, NM_182721.1 [Q03060-24]
NP_874392.1, NM_182723.1 [Q03060-23]
NP_874393.1, NM_182724.1 [Q03060-27]
NP_877570.1, NM_182769.2 [Q03060-7]
NP_877571.1, NM_182770.2
NP_877572.1, NM_182771.1 [Q03060-12]
NP_877573.1, NM_182772.1
NP_898829.1, NM_183011.1 [Q03060-31]
NP_898830.1, NM_183012.1 [Q03060-32]
NP_898831.1, NM_183013.2 [Q03060-26]
NP_898883.1, NM_183060.2 [Q03060-30]
XP_006717441.1, XM_006717378.3 [Q03060-16]
XP_006717442.1, XM_006717379.3 [Q03060-31]
XP_006717445.1, XM_006717382.3 [Q03060-2]
XP_006717446.1, XM_006717383.3 [Q03060-32]
XP_011517626.1, XM_011519324.2 [Q03060-15]
XP_011517627.1, XM_011519325.2 [Q03060-15]
XP_016871211.1, XM_017015722.1 [Q03060-30]

3D structure databases

SMRiQ03060
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107780, 26 interactors
IntActiQ03060, 28 interactors
MINTiQ03060

PTM databases

iPTMnetiQ03060
PhosphoSitePlusiQ03060

Polymorphism and mutation databases

BioMutaiCREM
DMDMi259016392

Proteomic databases

jPOSTiQ03060
MaxQBiQ03060
PeptideAtlasiQ03060
PRIDEiQ03060
ProteomicsDBi58163
58164 [Q03060-1]
58165 [Q03060-10]
58166 [Q03060-11]
58167 [Q03060-12]
58168 [Q03060-13]
58169 [Q03060-14]
58170 [Q03060-15]
58171 [Q03060-16]
58172 [Q03060-17]
58173 [Q03060-19]
58174 [Q03060-2]
58175 [Q03060-20]
58176 [Q03060-21]
58177 [Q03060-22]
58178 [Q03060-23]
58179 [Q03060-24]
58180 [Q03060-25]
58181 [Q03060-6]
58182 [Q03060-7]
58183 [Q03060-8]
58184 [Q03060-9]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		1390
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337656; ENSP00000337138; ENSG00000095794 [Q03060-31]
ENST00000342105; ENSP00000341875; ENSG00000095794 [Q03060-7]
ENST00000345491; ENSP00000265372; ENSG00000095794 [Q03060-16]
ENST00000348787; ENSP00000345384; ENSG00000095794 [Q03060-30]
ENST00000354759; ENSP00000346804; ENSG00000095794 [Q03060-26]
ENST00000356917; ENSP00000349387; ENSG00000095794 [Q03060-9]
ENST00000361599; ENSP00000354593; ENSG00000095794 [Q03060-12]
ENST00000374726; ENSP00000363858; ENSG00000095794 [Q03060-25]
ENST00000374728; ENSP00000363860; ENSG00000095794 [Q03060-30]
ENST00000374734; ENSP00000363866; ENSG00000095794 [Q03060-32]
ENST00000395887; ENSP00000379225; ENSG00000095794 [Q03060-22]
ENST00000429130; ENSP00000393538; ENSG00000095794 [Q03060-5]
ENST00000439705; ENSP00000409220; ENSG00000095794 [Q03060-26]
ENST00000463314; ENSP00000418336; ENSG00000095794 [Q03060-28]
ENST00000468236; ENSP00000419810; ENSG00000095794 [Q03060-29]
ENST00000473940; ENSP00000420681; ENSG00000095794 [Q03060-8]
ENST00000474931; ENSP00000417562; ENSG00000095794 [Q03060-24]
ENST00000479070; ENSP00000420511; ENSG00000095794 [Q03060-15]
ENST00000487763; ENSP00000417807; ENSG00000095794 [Q03060-10]
ENST00000488328; ENSP00000417460; ENSG00000095794 [Q03060-11]
ENST00000488741; ENSP00000419075; ENSG00000095794 [Q03060-23]
ENST00000489321; ENSP00000419924; ENSG00000095794 [Q03060-25]
ENST00000490511; ENSP00000417327; ENSG00000095794 [Q03060-27]
GeneIDi1390
KEGGihsa:1390
UCSCiuc001ixx.4 human [Q03060-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1390
DisGeNETi1390

GeneCards: human genes, protein and diseases

More...GeneCardsi		CREM
HGNCiHGNC:2352 CREM
HPAiCAB018352
HPA001818
MIMi123812 gene
neXtProtiNX_Q03060
OpenTargetsiENSG00000095794
PharmGKBiPA26871

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000156952
HOGENOMiHOG000007365
InParanoidiQ03060
KOiK09052
OMAiESAHMQT
OrthoDBi957343at2759
PhylomeDBiQ03060
TreeFamiTF106464

Enzyme and pathway databases

ReactomeiR-HSA-400253 Circadian Clock
SignaLinkiQ03060
SIGNORiQ03060

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CREM human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CAMP_responsive_element_modulator

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1390

Protein Ontology

More...PROi		PR:Q03060

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000095794 Expressed in 219 organ(s), highest expression level in right testis
ExpressionAtlasiQ03060 baseline and differential
GenevisibleiQ03060 HS

Family and domain databases

InterProiView protein in InterPro
IPR004827 bZIP
IPR003102 Coactivator_CBP_pKID
IPR001630 Leuzip_CREB
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PF02173 pKID, 1 hit
PRINTSiPR00041 LEUZIPPRCREB
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit
PS50953 KID, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCREM_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q03060
Secondary accession number(s): A8K014
, A8K3J7, A8K6A1, A8MPQ2, B4DXC1, C9J785, C9JZ10, E9PAR4, E9PHM1, O75519, Q14501, Q14503, Q14504, Q14505, Q14506, Q15731, Q16114, Q16116, Q5T9H7, Q5W1A6, Q5W1A7, Q5W1A8, Q5W1A9, Q5W1B0, Q5W1B2, Q7Z2Q6, Q8IVD4, Q96AG7, Q9NZ98, Q9NZ99, Q9NZB9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: September 12, 2018
Last modified: May 8, 2019
This is version 191 of the entry and version 6 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again