Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor 1 A-type

Gene

Nfia

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi24 – 217CTF/NF-IPROSITE-ProRule annotationAdd BLAST194

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processDNA replication, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
Gene namesi
Name:Nfia
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:108056 Nfia

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001001921 – 532Nuclear factor 1 A-typeAdd BLAST532

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei281PhosphoserineBy similarity1
Modified residuei288PhosphoserineBy similarity1
Modified residuei303PhosphoserineCombined sources1
Modified residuei310PhosphoserineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei328PhosphoserineBy similarity1
Modified residuei342PhosphoserineCombined sources1
Modified residuei383PhosphoserineBy similarity1
Modified residuei412Asymmetric dimethylarginineCombined sources1
Modified residuei492PhosphoserineBy similarity1
Modified residuei494PhosphothreonineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ02780
PaxDbiQ02780
PeptideAtlasiQ02780
PRIDEiQ02780

PTM databases

CarbonylDBiQ02780
iPTMnetiQ02780
PhosphoSitePlusiQ02780

Miscellaneous databases

PMAP-CutDBiQ02780

Expressioni

Gene expression databases

BgeeiENSMUSG00000028565 Expressed in 323 organ(s), highest expression level in cerebellum
CleanExiMM_NFIA
ExpressionAtlasiQ02780 baseline and differential
GenevisibleiQ02780 MM

Interactioni

Subunit structurei

Binds DNA as a homodimer.

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ02780, 2 interactors
MINTiQ02780
STRINGi10090.ENSMUSP00000074899

Structurei

3D structure databases

ProteinModelPortaliQ02780
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3663 Eukaryota
ENOG410Y16G LUCA
GeneTreeiENSGT00390000009905
HOVERGENiHBG006561
InParanoidiQ02780
KOiK09168
OMAiKEQPENG
OrthoDBiEOG091G0HVY
PhylomeDBiQ02780
TreeFamiTF313889

Family and domain databases

InterProiView protein in InterPro
IPR000647 CTF/NFI
IPR020604 CTF/NFI_DNA-bd-dom
IPR019739 CTF/NFI_DNA-bd_CS
IPR019548 CTF/NFI_DNA-bd_N
IPR003619 MAD_homology1_Dwarfin-type
PANTHERiPTHR11492 PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859 CTF_NFI, 1 hit
PF03165 MH1, 1 hit
PF10524 NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523 DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349 CTF_NFI_1, 1 hit
PS51080 CTF_NFI_2, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q02780-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLADSVMAG KASDGSIKWQ LCYDISARTW WMDEFHPFIE ALLPHVRAFA
60 70 80 90 100
YTWFNLQARK RKYFKKHEKR MSKEEERAVK DELLSEKPEV KQKWASRLLA
110 120 130 140 150
KLRKDIRPEY REDFVLTVTG KKPPCCVLSN PDQKGKMRRI DCLRQADKVW
160 170 180 190 200
RLDLVMVILF KGIPLESTDG ERLVKSPQCS NPGLCVQPHH IGVSVKELDL
210 220 230 240 250
YLAYFVHAAD SSQSESPSQP SEADIKDQPE NGHLGFQDSF VTSGVFSVTE
260 270 280 290 300
LVRVSQTPIA AGTGPNFSLS DLESSSYYSM SPGAMRRSLP STSSTSSTKR
310 320 330 340 350
LKSVEDEMDS PGEEPFYTGQ GRSPGSGSQS SGWHEVEPGL PSPSTLKKSE
360 370 380 390 400
KSGFSSPSPS QTSSLGTAFT QHHRPVITGP RASPHATPST LHFPTSPIIQ
410 420 430 440 450
QPGPYFSHPA IRYHPQETLK EFVQLVCPDA GQQAGQVGFL NPNGSSQGKV
460 470 480 490 500
HNPFLPTPML PPPPPPPMAR PVPLPMPDTK PPTTSTEGGA ASPTSPTYST
510 520 530
PSTSPANRFV SVGPRDPSFV NIPQQTQSWY LG
Length:532
Mass (Da):58,553
Last modified:November 1, 1996 - v1
Checksum:i3AECEEDCD65D28B3
GO
Isoform 1 (identifier: Q02780-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     476-532: Missing.

Show »
Length:452
Mass (Da):49,978
Checksum:i0A60CD21134D916D
GO
Isoform 3 (identifier: Q02780-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:501
Mass (Da):55,052
Checksum:i253D52DC51479989
GO
Isoform 4 (identifier: Q02780-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → VWFQQPLPFADLLPGNSIHTASPTCLTQ

Note: Incomplete sequence.
Show »
Length:528
Mass (Da):57,985
Checksum:i246B72B15F8C49F6
GO
Isoform 5 (identifier: Q02780-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     339-381: Missing.

Note: Incomplete sequence.
Show »
Length:466
Mass (Da):51,497
Checksum:iCC9057763FE44CD3
GO
Isoform 6 (identifier: Q02780-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → LSPPLSPSRTHTHAHLQPAHRRARTPRRPAVMYSPLCLTQ
     340-370: LPSPSTLKKSEKSGFSSPSPSQTSSLGTAFT → EQSHKREGNGVCVWLCCHGRVVESSRYNGSA
     371-532: Missing.

Note: Incomplete sequence.
Show »
Length:378
Mass (Da):42,408
Checksum:iC6B7E8EB9DE5378A
GO
Isoform 7 (identifier: Q02780-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ

Show »
Length:509
Mass (Da):55,958
Checksum:iE029E97576C19C55
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AUC0B1AUC0_MOUSE
Nuclear factor 1
Nfia
498Annotation score:
B1AUB9B1AUB9_MOUSE
Nuclear factor 1
Nfia
487Annotation score:
B1AUB8B1AUB8_MOUSE
Nuclear factor 1
Nfia
380Annotation score:
B1AUB6B1AUB6_MOUSE
Nuclear factor 1
Nfia
225Annotation score:
F7CDR2F7CDR2_MOUSE
Nuclear factor 1 A-type
Nfia
274Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0035371 – 32MKLAD…RTWWM → MYSPLCLTQ in isoform 1, isoform 5 and isoform 7. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_0035391 – 32MKLAD…RTWWM → VWFQQPLPFADLLPGNSIHT ASPTCLTQ in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0035401 – 32MKLAD…RTWWM → LSPPLSPSRTHTHAHLQPAH RRARTPRRPAVMYSPLCLTQ in isoform 6. CuratedAdd BLAST32
Alternative sequenceiVSP_0035381 – 31Missing in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_003541339 – 381Missing in isoform 5. CuratedAdd BLAST43
Alternative sequenceiVSP_003542340 – 370LPSPS…GTAFT → EQSHKREGNGVCVWLCCHGR VVESSRYNGSA in isoform 6. CuratedAdd BLAST31
Alternative sequenceiVSP_003543371 – 532Missing in isoform 6. CuratedAdd BLAST162
Alternative sequenceiVSP_003544476 – 532Missing in isoform 1. 2 PublicationsAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90172 mRNA Translation: BAA20909.1
D90173 mRNA Translation: BAA14203.1
D90174 mRNA Translation: BAA14204.1
D90175 mRNA Translation: BAA14205.1
D90176 mRNA Translation: BAA14206.1
AF326554 mRNA Translation: AAL37400.1
AF326553 mRNA Translation: AAL37399.1
Y07690 mRNA Translation: CAA68954.1
Y07691 mRNA Translation: CAA68955.1
AK137731 mRNA Translation: BAE23481.1
AK052204 mRNA Translation: BAC34883.1
U57633 mRNA Translation: AAB49928.1
AF111263 Genomic DNA Translation: AAD39098.1
CCDSiCCDS18373.1 [Q02780-7]
CCDS51234.1 [Q02780-5]
PIRiB36596
RefSeqiNP_001116424.1, NM_001122952.1 [Q02780-1]
NP_001116425.1, NM_001122953.1 [Q02780-5]
NP_035035.1, NM_010905.3 [Q02780-7]
XP_006502905.1, XM_006502842.3 [Q02780-3]
UniGeneiMm.31274
Mm.409646

Genome annotation databases

EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565 [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565 [Q02780-5]
GeneIDi18027
KEGGimmu:18027
UCSCiuc008tts.2 mouse [Q02780-1]
uc008ttt.2 mouse [Q02780-6]
uc008ttu.2 mouse [Q02780-7]
uc008ttv.2 mouse [Q02780-5]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90172 mRNA Translation: BAA20909.1
D90173 mRNA Translation: BAA14203.1
D90174 mRNA Translation: BAA14204.1
D90175 mRNA Translation: BAA14205.1
D90176 mRNA Translation: BAA14206.1
AF326554 mRNA Translation: AAL37400.1
AF326553 mRNA Translation: AAL37399.1
Y07690 mRNA Translation: CAA68954.1
Y07691 mRNA Translation: CAA68955.1
AK137731 mRNA Translation: BAE23481.1
AK052204 mRNA Translation: BAC34883.1
U57633 mRNA Translation: AAB49928.1
AF111263 Genomic DNA Translation: AAD39098.1
CCDSiCCDS18373.1 [Q02780-7]
CCDS51234.1 [Q02780-5]
PIRiB36596
RefSeqiNP_001116424.1, NM_001122952.1 [Q02780-1]
NP_001116425.1, NM_001122953.1 [Q02780-5]
NP_035035.1, NM_010905.3 [Q02780-7]
XP_006502905.1, XM_006502842.3 [Q02780-3]
UniGeneiMm.31274
Mm.409646

3D structure databases

ProteinModelPortaliQ02780
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ02780, 2 interactors
MINTiQ02780
STRINGi10090.ENSMUSP00000074899

PTM databases

CarbonylDBiQ02780
iPTMnetiQ02780
PhosphoSitePlusiQ02780

Proteomic databases

MaxQBiQ02780
PaxDbiQ02780
PeptideAtlasiQ02780
PRIDEiQ02780

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565 [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565 [Q02780-5]
GeneIDi18027
KEGGimmu:18027
UCSCiuc008tts.2 mouse [Q02780-1]
uc008ttt.2 mouse [Q02780-6]
uc008ttu.2 mouse [Q02780-7]
uc008ttv.2 mouse [Q02780-5]

Organism-specific databases

CTDi4774
MGIiMGI:108056 Nfia

Phylogenomic databases

eggNOGiKOG3663 Eukaryota
ENOG410Y16G LUCA
GeneTreeiENSGT00390000009905
HOVERGENiHBG006561
InParanoidiQ02780
KOiK09168
OMAiKEQPENG
OrthoDBiEOG091G0HVY
PhylomeDBiQ02780
TreeFamiTF313889

Miscellaneous databases

ChiTaRSiNfia mouse
PMAP-CutDBiQ02780
PROiPR:Q02780
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028565 Expressed in 323 organ(s), highest expression level in cerebellum
CleanExiMM_NFIA
ExpressionAtlasiQ02780 baseline and differential
GenevisibleiQ02780 MM

Family and domain databases

InterProiView protein in InterPro
IPR000647 CTF/NFI
IPR020604 CTF/NFI_DNA-bd-dom
IPR019739 CTF/NFI_DNA-bd_CS
IPR019548 CTF/NFI_DNA-bd_N
IPR003619 MAD_homology1_Dwarfin-type
PANTHERiPTHR11492 PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859 CTF_NFI, 1 hit
PF03165 MH1, 1 hit
PF10524 NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523 DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349 CTF_NFI_1, 1 hit
PS51080 CTF_NFI_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNFIA_MOUSE
AccessioniPrimary (citable) accession number: Q02780
Secondary accession number(s): P70250
, P70251, Q3UUZ2, Q61960, Q8VBT5, Q9R1G5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 166 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again