Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 179 (12 Aug 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear factor 1 A-type

Gene

Nfia

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi24 – 217CTF/NF-IPROSITE-ProRule annotationAdd BLAST194

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processDNA replication, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nfia
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:108056, Nfia

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001001921 – 532Nuclear factor 1 A-typeAdd BLAST532

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei281PhosphoserineBy similarity1
Modified residuei288PhosphoserineBy similarity1
Modified residuei303PhosphoserineCombined sources1
Modified residuei310PhosphoserineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei328PhosphoserineBy similarity1
Modified residuei342PhosphoserineCombined sources1
Modified residuei383PhosphoserineBy similarity1
Modified residuei412Asymmetric dimethylarginineCombined sources1
Modified residuei492PhosphoserineBy similarity1
Modified residuei494PhosphothreonineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q02780

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q02780

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q02780

PeptideAtlas

More...
PeptideAtlasi
Q02780

PRoteomics IDEntifications database

More...
PRIDEi
Q02780

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q02780

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q02780

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q02780

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028565, Expressed in cerebellum and 337 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q02780, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q02780, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer.

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q02780, 2 interactors

Molecular INTeraction database

More...
MINTi
Q02780

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000074899

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q02780, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi417 – 4259aaTADBy similarity9

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3663, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182916

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q02780

KEGG Orthology (KO)

More...
KOi
K09168

Identification of Orthologs from Complete Genome Data

More...
OMAi
XSPHATP

Database of Orthologous Groups

More...
OrthoDBi
967862at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q02780

TreeFam database of animal gene trees

More...
TreeFami
TF313889

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000647, CTF/NFI
IPR020604, CTF/NFI_DNA-bd-dom
IPR019739, CTF/NFI_DNA-bd_CS
IPR019548, CTF/NFI_DNA-bd_N
IPR003619, MAD_homology1_Dwarfin-type

The PANTHER Classification System

More...
PANTHERi
PTHR11492, PTHR11492, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00859, CTF_NFI, 1 hit
PF03165, MH1, 1 hit
PF10524, NfI_DNAbd_pre-N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00523, DWA, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00349, CTF_NFI_1, 1 hit
PS51080, CTF_NFI_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q02780-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLADSVMAG KASDGSIKWQ LCYDISARTW WMDEFHPFIE ALLPHVRAFA
60 70 80 90 100
YTWFNLQARK RKYFKKHEKR MSKEEERAVK DELLSEKPEV KQKWASRLLA
110 120 130 140 150
KLRKDIRPEY REDFVLTVTG KKPPCCVLSN PDQKGKMRRI DCLRQADKVW
160 170 180 190 200
RLDLVMVILF KGIPLESTDG ERLVKSPQCS NPGLCVQPHH IGVSVKELDL
210 220 230 240 250
YLAYFVHAAD SSQSESPSQP SEADIKDQPE NGHLGFQDSF VTSGVFSVTE
260 270 280 290 300
LVRVSQTPIA AGTGPNFSLS DLESSSYYSM SPGAMRRSLP STSSTSSTKR
310 320 330 340 350
LKSVEDEMDS PGEEPFYTGQ GRSPGSGSQS SGWHEVEPGL PSPSTLKKSE
360 370 380 390 400
KSGFSSPSPS QTSSLGTAFT QHHRPVITGP RASPHATPST LHFPTSPIIQ
410 420 430 440 450
QPGPYFSHPA IRYHPQETLK EFVQLVCPDA GQQAGQVGFL NPNGSSQGKV
460 470 480 490 500
HNPFLPTPML PPPPPPPMAR PVPLPMPDTK PPTTSTEGGA ASPTSPTYST
510 520 530
PSTSPANRFV SVGPRDPSFV NIPQQTQSWY LG
Length:532
Mass (Da):58,553
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3AECEEDCD65D28B3
GO
Isoform 1 (identifier: Q02780-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     476-532: Missing.

Show »
Length:452
Mass (Da):49,978
Checksum:i0A60CD21134D916D
GO
Isoform 3 (identifier: Q02780-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:501
Mass (Da):55,052
Checksum:i253D52DC51479989
GO
Isoform 4 (identifier: Q02780-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → VWFQQPLPFADLLPGNSIHTASPTCLTQ

Note: Incomplete sequence.Curated
Show »
Length:528
Mass (Da):57,985
Checksum:i246B72B15F8C49F6
GO
Isoform 5 (identifier: Q02780-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     339-381: Missing.

Note: Incomplete sequence.Curated
Show »
Length:466
Mass (Da):51,497
Checksum:iCC9057763FE44CD3
GO
Isoform 6 (identifier: Q02780-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → LSPPLSPSRTHTHAHLQPAHRRARTPRRPAVMYSPLCLTQ
     340-370: LPSPSTLKKSEKSGFSSPSPSQTSSLGTAFT → EQSHKREGNGVCVWLCCHGRVVESSRYNGSA
     371-532: Missing.

Note: Incomplete sequence.Curated
Show »
Length:378
Mass (Da):42,408
Checksum:iC6B7E8EB9DE5378A
GO
Isoform 7 (identifier: Q02780-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ

Show »
Length:509
Mass (Da):55,958
Checksum:iE029E97576C19C55
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AUC0B1AUC0_MOUSE
Nuclear factor 1
Nfia
498Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AUB9B1AUB9_MOUSE
Nuclear factor 1
Nfia
487Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AUB8B1AUB8_MOUSE
Nuclear factor 1
Nfia
380Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AUB6B1AUB6_MOUSE
Nuclear factor 1
Nfia
225Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7CDR2F7CDR2_MOUSE
Nuclear factor 1 A-type
Nfia
274Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0035371 – 32MKLAD…RTWWM → MYSPLCLTQ in isoform 1, isoform 5 and isoform 7. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_0035391 – 32MKLAD…RTWWM → VWFQQPLPFADLLPGNSIHT ASPTCLTQ in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0035401 – 32MKLAD…RTWWM → LSPPLSPSRTHTHAHLQPAH RRARTPRRPAVMYSPLCLTQ in isoform 6. CuratedAdd BLAST32
Alternative sequenceiVSP_0035381 – 31Missing in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_003541339 – 381Missing in isoform 5. CuratedAdd BLAST43
Alternative sequenceiVSP_003542340 – 370LPSPS…GTAFT → EQSHKREGNGVCVWLCCHGR VVESSRYNGSA in isoform 6. CuratedAdd BLAST31
Alternative sequenceiVSP_003543371 – 532Missing in isoform 6. CuratedAdd BLAST162
Alternative sequenceiVSP_003544476 – 532Missing in isoform 1. 2 PublicationsAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D90172 mRNA Translation: BAA20909.1
D90173 mRNA Translation: BAA14203.1
D90174 mRNA Translation: BAA14204.1
D90175 mRNA Translation: BAA14205.1
D90176 mRNA Translation: BAA14206.1
AF326554 mRNA Translation: AAL37400.1
AF326553 mRNA Translation: AAL37399.1
Y07690 mRNA Translation: CAA68954.1
Y07691 mRNA Translation: CAA68955.1
AK137731 mRNA Translation: BAE23481.1
AK052204 mRNA Translation: BAC34883.1
U57633 mRNA Translation: AAB49928.1
AF111263 Genomic DNA Translation: AAD39098.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18373.1 [Q02780-7]
CCDS51234.1 [Q02780-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
B36596

NCBI Reference Sequences

More...
RefSeqi
NP_001116424.1, NM_001122952.1 [Q02780-1]
NP_001116425.1, NM_001122953.1 [Q02780-5]
NP_035035.1, NM_010905.3 [Q02780-7]
XP_006502905.1, XM_006502842.3 [Q02780-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565 [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565 [Q02780-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18027

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18027

UCSC genome browser

More...
UCSCi
uc008tts.2, mouse [Q02780-1]
uc008ttt.2, mouse [Q02780-6]
uc008ttu.2, mouse [Q02780-7]
uc008ttv.2, mouse [Q02780-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90172 mRNA Translation: BAA20909.1
D90173 mRNA Translation: BAA14203.1
D90174 mRNA Translation: BAA14204.1
D90175 mRNA Translation: BAA14205.1
D90176 mRNA Translation: BAA14206.1
AF326554 mRNA Translation: AAL37400.1
AF326553 mRNA Translation: AAL37399.1
Y07690 mRNA Translation: CAA68954.1
Y07691 mRNA Translation: CAA68955.1
AK137731 mRNA Translation: BAE23481.1
AK052204 mRNA Translation: BAC34883.1
U57633 mRNA Translation: AAB49928.1
AF111263 Genomic DNA Translation: AAD39098.1
CCDSiCCDS18373.1 [Q02780-7]
CCDS51234.1 [Q02780-5]
PIRiB36596
RefSeqiNP_001116424.1, NM_001122952.1 [Q02780-1]
NP_001116425.1, NM_001122953.1 [Q02780-5]
NP_035035.1, NM_010905.3 [Q02780-7]
XP_006502905.1, XM_006502842.3 [Q02780-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ02780, 2 interactors
MINTiQ02780
STRINGi10090.ENSMUSP00000074899

PTM databases

CarbonylDBiQ02780
iPTMnetiQ02780
PhosphoSitePlusiQ02780

Proteomic databases

jPOSTiQ02780
MaxQBiQ02780
PaxDbiQ02780
PeptideAtlasiQ02780
PRIDEiQ02780

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1812, 265 antibodies

Genome annotation databases

EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565 [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565 [Q02780-5]
GeneIDi18027
KEGGimmu:18027
UCSCiuc008tts.2, mouse [Q02780-1]
uc008ttt.2, mouse [Q02780-6]
uc008ttu.2, mouse [Q02780-7]
uc008ttv.2, mouse [Q02780-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4774
MGIiMGI:108056, Nfia

Phylogenomic databases

eggNOGiKOG3663, Eukaryota
GeneTreeiENSGT00950000182916
InParanoidiQ02780
KOiK09168
OMAiXSPHATP
OrthoDBi967862at2759
PhylomeDBiQ02780
TreeFamiTF313889

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
18027, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nfia, mouse

Protein Ontology

More...
PROi
PR:Q02780
RNActiQ02780, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028565, Expressed in cerebellum and 337 other tissues
ExpressionAtlasiQ02780, baseline and differential
GenevisibleiQ02780, MM

Family and domain databases

InterProiView protein in InterPro
IPR000647, CTF/NFI
IPR020604, CTF/NFI_DNA-bd-dom
IPR019739, CTF/NFI_DNA-bd_CS
IPR019548, CTF/NFI_DNA-bd_N
IPR003619, MAD_homology1_Dwarfin-type
PANTHERiPTHR11492, PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859, CTF_NFI, 1 hit
PF03165, MH1, 1 hit
PF10524, NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523, DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349, CTF_NFI_1, 1 hit
PS51080, CTF_NFI_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFIA_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q02780
Secondary accession number(s): P70250
, P70251, Q3UUZ2, Q61960, Q8VBT5, Q9R1G5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: November 1, 1996
Last modified: August 12, 2020
This is version 179 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again