Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q02548 (PAX5_HUMAN)

Entry version 197 (23 Feb 2022)
Sequence version 1 (01 Oct 1993)
Previous versions | rss
Add a publicationFeedback
Protein

Paired box protein Pax-5

Gene

PAX5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage (PubMed:10811620, PubMed:27181361).

Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes (PubMed:10811620, PubMed:27181361).

In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage (PubMed:32612238).

Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire (PubMed:32612238).

3 Publications

(Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription (PubMed:31941781).

Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity (PubMed:23678172).

2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi16 – 142PairedPROSITE-ProRule annotationAdd BLAST127

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processDifferentiation, Neurogenesis, Spermatogenesis, Transcription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q02548

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8939245, RUNX1 regulates transcription of genes involved in BCR signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q02548

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q02548

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Paired box protein Pax-5
Alternative name(s):
B-cell-specific transcription factor
Short name:
BSAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PAX5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8619, PAX5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		167414, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q02548

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000196092

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving PAX5 is a cause of acute lymphoblastic leukemia. Translocation t(9;18)(p13;q11.2) with ZNF521. Translocation t(9;3)(p13;p14.1) with FOXP1. Translocation t(9;12)(p13;p13) with ETV6.1 Publication
Leukemia, acute lymphoblastic, 3 (ALL3)1 Publication
Disease susceptibility is associated with variants affecting the gene represented in this entry.
Disease descriptionA subtype of acute leukemia, a cancer of the white blood cells. Acute lymphoblastic anemia is a malignant disease of bone marrow and the most common malignancy diagnosed in children. The malignant cells are lymphoid precursor cells (lymphoblasts) that are arrested in an early stage of development. The lymphoblasts replace the normal marrow elements, resulting in a marked decrease in the production of normal blood cells. Consequently, anemia, thrombocytopenia, and neutropenia occur to varying degrees. The lymphoblasts also proliferate in organs other than the marrow, particularly the liver, spleen, and lymphnodes.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_070682183G → S in ALL3; confers susceptibility to ALL3; reduced transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs398123063EnsemblClinVar.1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei158 – 159Breakpoint for translocation to form PAX5-ETV62
Sitei260 – 261Breakpoint for translocation to form PAX5-FOXP12
Sitei303 – 304Breakpoint for translocation to form PAX5-ZNF5212

Keywords - Diseasei

Disease variant, Proto-oncogene

Organism-specific databases

DisGeNET

More...DisGeNETi		5079

MalaCards human disease database

More...MalaCardsi		PAX5
MIMi613065, phenotype

Open Targets

More...OpenTargetsi		ENSG00000196092

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		99860, Precursor B-cell acute lymphoblastic leukemia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA32959

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q02548, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PAX5

Domain mapping of disease mutations (DMDM)

More...DMDMi		417449

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000501831 – 391Paired box protein Pax-5Add BLAST391

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.Curated
Phosphorylated by SYK. This phosphorylation plays an important role in the abolition of BLIMP1 repression by PAX5 in order to trigger plasma cell differentiation.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q02548

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q02548

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q02548

PeptideAtlas

More...PeptideAtlasi		Q02548

PRoteomics IDEntifications database

More...PRIDEi		Q02548

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		58109 [Q02548-1]
67344
67345
67346
7578
7579
7580
7581
7582

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q02548

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q02548

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at early B-cell differentiation, in the developing CNS and in adult testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000196092, Expressed in buccal mucosa cell and 135 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q02548, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q02548, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000196092, Tissue enriched (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ETS1; this interaction alters PAX5 DNA-binding properties (PubMed:11779502). Binds DNA as a monomer (PubMed:11779502).

Interacts with TBP; this interaction allows PAX5 to interact with the basal transcription machinery (PubMed:10197586).

Interacts with RB1 (PubMed:10197586).

Interacts with TLE4 (PubMed:10811620).

Interacts with DAXX (By similarity).

By similarity3 Publications

(Microbial infection) Interacts (via N-terminus) with Epstein-Barr virus protein BZLF1 (via C-terminus); this interaction inhibits BZLF1-mediated lytic viral reactivation (PubMed:23678172).

Interacts also with EBNA1; this interaction promotes EBNA1-dependent transcription (PubMed:31941781).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
Q02548
With#Exp.IntAct
ACOT12 [Q8WYK0]3EBI-296331,EBI-11954993
BCAS2 [O75934]3EBI-296331,EBI-1050106
C1orf109 [Q9NX04]3EBI-296331,EBI-8643161
CCNC [P24863]3EBI-296331,EBI-395261
CDK3 [Q00526]3EBI-296331,EBI-1245761
CIB3 [Q96Q77]3EBI-296331,EBI-10292696
CKS1B [P61024]3EBI-296331,EBI-456371
CSNK2A1 [P68400]3EBI-296331,EBI-347804
CXorf38 [Q8TB03]3EBI-296331,EBI-12024320
DTX2 [Q86UW9]3EBI-296331,EBI-740376
FBLN1 - isoform C [P23142-4]3EBI-296331,EBI-11956479
GNG13 [Q9P2W3]3EBI-296331,EBI-11427343
GRHL2 [Q6ISB3]3EBI-296331,EBI-10219092
HGS [O14964]3EBI-296331,EBI-740220
HMBOX1 [Q6NT76]3EBI-296331,EBI-2549423
HMGB3 [O15347]3EBI-296331,EBI-2214136
HOXC8 [P31273]3EBI-296331,EBI-1752118
KLHL38 [Q2WGJ6]3EBI-296331,EBI-6426443
MLL cleavage product N320 (PRO_0000390949)2EBI-296331,EBI-2610266
KRTAP10-8 [P60410]3EBI-296331,EBI-10171774
KRTAP9-3 [Q9BYQ3]3EBI-296331,EBI-1043191
LARP4 [Q6P4E2]3EBI-296331,EBI-12079790
LDLRAP1 [Q5SW96]3EBI-296331,EBI-747813
LONRF1 [Q17RB8]3EBI-296331,EBI-2341787
MAPK9 [P45984]3EBI-296331,EBI-713568
NEIL2 [Q969S2]3EBI-296331,EBI-10281234
NFYC - isoform 1 [Q13952-2]3EBI-296331,EBI-11956831
NGLY1 [Q96IV0]3EBI-296331,EBI-6165879
OSGIN1 [Q9UJX0]3EBI-296331,EBI-9057006
PNMA5 [Q96PV4]3EBI-296331,EBI-10171633
RAD52 [P43351]3EBI-296331,EBI-706448
SAE1 [Q9UBE0]3EBI-296331,EBI-743154
SEC14L4 [Q9UDX3]3EBI-296331,EBI-10320311
STAC [Q99469]3EBI-296331,EBI-2652799
TLK2 [Q86UE8]3EBI-296331,EBI-1047967
UBE2I [Q7KZS0]3EBI-296331,EBI-10180829
UBXN2B [Q14CS0]3EBI-296331,EBI-1993619
UBXN7 [O94888]3EBI-296331,EBI-1993627
ZMYM5 - isoform 2 [Q9UJ78-2]3EBI-296331,EBI-17634549

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111113, 55 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q02548

Protein interaction database and analysis system

More...IntActi		Q02548, 43 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000350844

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q02548, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1391
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q02548

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q02548

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 21DisorderedSequence analysisAdd BLAST21
Regioni19 – 75PAI subdomainPROSITE-ProRule annotationAdd BLAST57
Regioni94 – 142RED subdomainPROSITE-ProRule annotationAdd BLAST49
Regioni182 – 218DisorderedSequence analysisAdd BLAST37

Keywords - Domaini

Paired box

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3862, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159636

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_019281_1_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q02548

Identification of Orthologs from Complete Genome Data

More...OMAi		IXIQESP

Database of Orthologous Groups

More...OrthoDBi		592933at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q02548

TreeFam database of animal gene trees

More...TreeFami		TF315397

Family and domain databases

Conserved Domains Database

More...CDDi		cd00131, PAX, 1 hit

Database of protein disorder

More...DisProti		DP00969

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.10.10, 2 hits

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00067

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009057, Homeobox-like_sf
IPR043182, PAIRED_DNA-bd_dom
IPR001523, Paired_dom
IPR022130, Pax2_C
IPR043565, PAX_fam
IPR036388, WH-like_DNA-bd_sf

The PANTHER Classification System

More...PANTHERi		PTHR45636, PTHR45636, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00292, PAX, 1 hit
PF12403, Pax2_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00027, PAIREDBOX

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00351, PAX, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46689, SSF46689, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00034, PAIRED_1, 1 hit
PS51057, PAIRED_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (11+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 11 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 11 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q02548-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLEKNYPTP RTSRTGHGGV NQLGGVFVNG RPLPDVVRQR IVELAHQGVR 
        60         70         80         90        100
PCDISRQLRV SHGCVSKILG RYYETGSIKP GVIGGSKPKV ATPKVVEKIA 
       110        120        130        140        150
EYKRQNPTMF AWEIRDRLLA ERVCDNDTVP SVSSINRIIR TKVQQPPNQP 
       160        170        180        190        200
VPASSHSIVS TGSVTQVSSV STDSAGSSYS ISGILGITSP SADTNKRKRD 
       210        220        230        240        250
EGIQESPVPN GHSLPGRDFL RKQMRGDLFT QQQLEVLDRV FERQHYSDIF 
       260        270        280        290        300
TTTEPIKPEQ TTEYSAMASL AGGLDDMKAN LASPTPADIG SSVPGPQSYP 
       310        320        330        340        350
IVTGRDLAST TLPGYPPHVP PAGQGSYSAP TLTGMVPGSE FSGSPYSHPQ 
       360        370        380        390 
YSSYNDSWRF PNPGLLGSPY YYSAAARGAA PPAAATAYDR H
Length:391
Mass (Da):42,149
Last modified:October 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB37E6EACD9F993A
GO
Isoform 2 (identifier: Q02548-2) [UniParc]FASTAAdd to basket
Also known as: delta9

The sequence of this isoform differs from the canonical sequence as follows:
     338-366: Missing.

Show »
Length:362
Mass (Da):38,890
Checksum:i6570B3D758CC4DFC
GO
Isoform 3 (identifier: Q02548-3) [UniParc]FASTAAdd to basket
Also known as: delta78

The sequence of this isoform differs from the canonical sequence as follows:
     261-282: TTEYSAMASLAGGLDDMKANLA → GVSFPGVPTATLSIPRTTTPGG
     286-315: PADIGSSVPGPQSYPIVTGRDLASTTLPGY → RGCLAPPIIIALPPEE
     319-391: VPPAGQGSYS...PAAATAYDRH → LQPPLPMTVTDPWSQAGTKH

Show »
Length:324
Mass (Da):35,281
Checksum:iF6A0BFF245B8B965
GO
Isoform 4 (identifier: Q02548-4) [UniParc]FASTAAdd to basket
Also known as: delta789

The sequence of this isoform differs from the canonical sequence as follows:
     261-315: TTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGY → APPIIIALPPEE
     319-391: VPPAGQGSYS...PAAATAYDRH → LQPPLPMTVTDPWSQAGTKH

Show »
Length:295
Mass (Da):32,471
Checksum:iD5EEA5066EE14214
GO
Isoform 5 (identifier: Q02548-5) [UniParc]FASTAAdd to basket
Also known as: delta8

The sequence of this isoform differs from the canonical sequence as follows:
     261-391: TTEYSAMASL...PAAATAYDRH → AVTWRARPSPGTLHTSPPLDRAATQHRR

Show »
Length:288
Mass (Da):31,830
Checksum:i38E17187FCE243A4
GO
Isoform 6 (identifier: Q02548-6) [UniParc]FASTAAdd to basket
Also known as: delta7

The sequence of this isoform differs from the canonical sequence as follows:
     305-349: RDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHP → SEFSGSPYSHP

Show »
Length:357
Mass (Da):38,773
Checksum:iD9002C0265083C8D
GO
Isoform 7 (identifier: Q02548-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-366: Missing.

Show »
Length:328
Mass (Da):35,514
Checksum:i92D63742F8C95496
GO
Isoform 8 (identifier: Q02548-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-201: Missing.

Show »
Length:348
Mass (Da):37,834
Checksum:i4A0BED6DADED06FC
GO
Isoform 9 (identifier: Q02548-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-201: Missing.
     338-366: Missing.

Show »
Length:319
Mass (Da):34,574
Checksum:i9478E6354E6E9B7B
GO
Isoform 10 (identifier: Q02548-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-136: Missing.
     304-337: Missing.

Show »
Length:291
Mass (Da):31,381
Checksum:i9DA0FDAAE882FD03
GO
Isoform 11 (identifier: Q02548-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-307: TTEYSAMASL...SYPIVTGRDL → WCPVLMRQYL...LDRAATQHRR
     308-391: Missing.

Show »
Length:307
Mass (Da):34,132
Checksum:i25F6F696F292DC04
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EQT0E7EQT0_HUMAN
Paired box protein Pax-5
PAX5
324Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ERW5E7ERW5_HUMAN
Paired box protein Pax-5
PAX5
295Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ES87E7ES87_HUMAN
Paired box protein Pax-5
PAX5
220Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ERK2E7ERK2_HUMAN
Paired box protein Pax-5
PAX5
283Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB47H0YB47_HUMAN
Paired box protein Pax-5
PAX5
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C0KTE2C0KTE2_HUMAN
B cell specific activator protein v...
PAX5
218Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti99I → F in AAC35286 (PubMed:9742255).Curated1
Sequence conflicti141 – 143TKV → PKL in AAC35286 (PubMed:9742255).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07067224G → R1 PublicationCorresponds to variant dbSNP:rs868494257Ensembl.1
Natural variantiVAR_07067326V → G1 PublicationCorresponds to variant dbSNP:rs926053251Ensembl.1
Natural variantiVAR_07067434P → Q1 Publication1
Natural variantiVAR_07067553D → V1 Publication1
Natural variantiVAR_07067659R → G1 Publication1
Natural variantiVAR_07067766S → N1 Publication1
Natural variantiVAR_07067875T → R1 Publication1
Natural variantiVAR_07067980P → R1 Publication1
Natural variantiVAR_070680139I → T1 Publication1
Natural variantiVAR_070681151V → I1 PublicationCorresponds to variant dbSNP:rs115889954EnsemblClinVar.1
Natural variantiVAR_070682183G → S in ALL3; confers susceptibility to ALL3; reduced transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs398123063EnsemblClinVar.1
Natural variantiVAR_070683183G → V1 Publication1
Natural variantiVAR_070684213S → L1 PublicationCorresponds to variant dbSNP:rs137870876EnsemblClinVar.1
Natural variantiVAR_070685301I → T1 PublicationCorresponds to variant dbSNP:rs372989600Ensembl.1
Natural variantiVAR_034370322A → T. Corresponds to variant dbSNP:rs34810717EnsemblClinVar.1
Natural variantiVAR_070686338G → V1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04782771 – 136Missing in isoform 10. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_047828159 – 201Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_044115261 – 391TTEYS…AYDRH → AVTWRARPSPGTLHTSPPLD RAATQHRR in isoform 5. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_044116261 – 315TTEYS…TLPGY → APPIIIALPPEE in isoform 4. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_047829261 – 307TTEYS…TGRDL → WCPVLMRQYLVQPQAVLFQA VTWRARPSPGTLHTSPPLDR AATQHRR in isoform 11. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_044117261 – 282TTEYS…KANLA → GVSFPGVPTATLSIPRTTTP GG in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_044118286 – 315PADIG…TLPGY → RGCLAPPIIIALPPEE in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_047830304 – 366Missing in isoform 7. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_047831304 – 337Missing in isoform 10. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_044119305 – 349RDLAS…PYSHP → SEFSGSPYSHP in isoform 6. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_047832308 – 391Missing in isoform 11. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_044120319 – 391VPPAG…AYDRH → LQPPLPMTVTDPWSQAGTKH in isoform 3 and isoform 4. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_044121338 – 366Missing in isoform 2 and isoform 9. 2 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M96944 mRNA Translation: AAA58397.1
AY463952 mRNA Translation: AAR27590.1
AY463953 mRNA Translation: AAR27591.1
AY463954 mRNA Translation: AAR27592.1
AY463955 mRNA Translation: AAR27593.1
AY463956 mRNA Translation: AAR27594.1
AY463957 mRNA Translation: AAR27595.1
FJ626421 mRNA Translation: ACM91604.1
FJ626422 mRNA Translation: ACM91605.1
FJ626423 mRNA Translation: ACM91606.1
FJ626424 mRNA Translation: ACM91607.1
FJ626425 mRNA Translation: ACM91608.1
EF064717 Genomic DNA Translation: ABK41900.1
AL161781 Genomic DNA No translation available.
AL450267 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58294.1
CH471071 Genomic DNA Translation: EAW58295.1
CH471071 Genomic DNA Translation: EAW58296.1
CH471071 Genomic DNA Translation: EAW58297.1
CH471071 Genomic DNA Translation: EAW58298.1
CH471071 Genomic DNA Translation: EAW58299.1
DQ841178 mRNA Translation: ABI30005.1 Different termination.
DQ845345 mRNA Translation: ABI33104.1 Different termination.
DQ845346 mRNA Translation: ABI33105.1 Different termination.
AF080573 mRNA Translation: AAC35286.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS65041.1 [Q02548-10]
CCDS65042.1 [Q02548-9]
CCDS65043.1 [Q02548-8]
CCDS65044.1 [Q02548-4]
CCDS65045.1 [Q02548-3]
CCDS65046.1 [Q02548-7]
CCDS65047.1 [Q02548-6]
CCDS65048.1 [Q02548-2]
CCDS6607.1 [Q02548-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A44063

NCBI Reference Sequences

More...RefSeqi		NP_001267476.1, NM_001280547.1 [Q02548-6]
NP_001267477.1, NM_001280548.1 [Q02548-2]
NP_001267478.1, NM_001280549.1
NP_001267479.1, NM_001280550.1
NP_001267481.1, NM_001280552.1 [Q02548-7]
NP_001267482.1, NM_001280553.1 [Q02548-9]
NP_001267483.1, NM_001280554.1 [Q02548-8]
NP_001267484.1, NM_001280555.1 [Q02548-10]
NP_001267485.1, NM_001280556.1
NP_057953.1, NM_016734.2 [Q02548-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000358127; ENSP00000350844; ENSG00000196092
ENST00000377840; ENSP00000367071; ENSG00000196092 [Q02548-5]
ENST00000377847; ENSP00000367078; ENSG00000196092 [Q02548-7]
ENST00000377852; ENSP00000367083; ENSG00000196092 [Q02548-6]
ENST00000377853; ENSP00000367084; ENSG00000196092 [Q02548-2]
ENST00000414447; ENSP00000412188; ENSG00000196092 [Q02548-8]
ENST00000446742; ENSP00000404687; ENSG00000196092 [Q02548-10]
ENST00000520281; ENSP00000430773; ENSG00000196092 [Q02548-9]
ENST00000523493; ENSP00000431038; ENSG00000196092 [Q02548-11]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5079

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5079

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000358127.9; ENSP00000350844.4; NM_016734.3; NP_057953.1

UCSC genome browser

More...UCSCi		uc003zzo.3, human [Q02548-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M96944 mRNA Translation: AAA58397.1
AY463952 mRNA Translation: AAR27590.1
AY463953 mRNA Translation: AAR27591.1
AY463954 mRNA Translation: AAR27592.1
AY463955 mRNA Translation: AAR27593.1
AY463956 mRNA Translation: AAR27594.1
AY463957 mRNA Translation: AAR27595.1
FJ626421 mRNA Translation: ACM91604.1
FJ626422 mRNA Translation: ACM91605.1
FJ626423 mRNA Translation: ACM91606.1
FJ626424 mRNA Translation: ACM91607.1
FJ626425 mRNA Translation: ACM91608.1
EF064717 Genomic DNA Translation: ABK41900.1
AL161781 Genomic DNA No translation available.
AL450267 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58294.1
CH471071 Genomic DNA Translation: EAW58295.1
CH471071 Genomic DNA Translation: EAW58296.1
CH471071 Genomic DNA Translation: EAW58297.1
CH471071 Genomic DNA Translation: EAW58298.1
CH471071 Genomic DNA Translation: EAW58299.1
DQ841178 mRNA Translation: ABI30005.1 Different termination.
DQ845345 mRNA Translation: ABI33104.1 Different termination.
DQ845346 mRNA Translation: ABI33105.1 Different termination.
AF080573 mRNA Translation: AAC35286.1
CCDSiCCDS65041.1 [Q02548-10]
CCDS65042.1 [Q02548-9]
CCDS65043.1 [Q02548-8]
CCDS65044.1 [Q02548-4]
CCDS65045.1 [Q02548-3]
CCDS65046.1 [Q02548-7]
CCDS65047.1 [Q02548-6]
CCDS65048.1 [Q02548-2]
CCDS6607.1 [Q02548-1]
PIRiA44063
RefSeqiNP_001267476.1, NM_001280547.1 [Q02548-6]
NP_001267477.1, NM_001280548.1 [Q02548-2]
NP_001267478.1, NM_001280549.1
NP_001267479.1, NM_001280550.1
NP_001267481.1, NM_001280552.1 [Q02548-7]
NP_001267482.1, NM_001280553.1 [Q02548-9]
NP_001267483.1, NM_001280554.1 [Q02548-8]
NP_001267484.1, NM_001280555.1 [Q02548-10]
NP_001267485.1, NM_001280556.1
NP_057953.1, NM_016734.2 [Q02548-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K78X-ray2.25A/E/I1-149[»]
1MDMX-ray2.80A1-149[»]
SMRiQ02548
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111113, 55 interactors
ELMiQ02548
IntActiQ02548, 43 interactors
STRINGi9606.ENSP00000350844

PTM databases

iPTMnetiQ02548
PhosphoSitePlusiQ02548

Genetic variation databases

BioMutaiPAX5
DMDMi417449

Proteomic databases

MassIVEiQ02548
MaxQBiQ02548
PaxDbiQ02548
PeptideAtlasiQ02548
PRIDEiQ02548
ProteomicsDBi58109 [Q02548-1]
67344
67345
67346
7578
7579
7580
7581
7582

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3668, 934 antibodies from 49 providers

The DNASU plasmid repository

More...DNASUi		5079

Genome annotation databases

EnsembliENST00000358127; ENSP00000350844; ENSG00000196092
ENST00000377840; ENSP00000367071; ENSG00000196092 [Q02548-5]
ENST00000377847; ENSP00000367078; ENSG00000196092 [Q02548-7]
ENST00000377852; ENSP00000367083; ENSG00000196092 [Q02548-6]
ENST00000377853; ENSP00000367084; ENSG00000196092 [Q02548-2]
ENST00000414447; ENSP00000412188; ENSG00000196092 [Q02548-8]
ENST00000446742; ENSP00000404687; ENSG00000196092 [Q02548-10]
ENST00000520281; ENSP00000430773; ENSG00000196092 [Q02548-9]
ENST00000523493; ENSP00000431038; ENSG00000196092 [Q02548-11]
GeneIDi5079
KEGGihsa:5079
MANE-SelectiENST00000358127.9; ENSP00000350844.4; NM_016734.3; NP_057953.1
UCSCiuc003zzo.3, human [Q02548-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5079
DisGeNETi5079

GeneCards: human genes, protein and diseases

More...GeneCardsi		PAX5
HGNCiHGNC:8619, PAX5
HPAiENSG00000196092, Tissue enriched (lymphoid)
MalaCardsiPAX5
MIMi167414, gene
613065, phenotype
neXtProtiNX_Q02548
OpenTargetsiENSG00000196092
Orphaneti99860, Precursor B-cell acute lymphoblastic leukemia
PharmGKBiPA32959
VEuPathDBiHostDB:ENSG00000196092

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3862, Eukaryota
GeneTreeiENSGT00940000159636
HOGENOMiCLU_019281_1_3_1
InParanoidiQ02548
OMAiIXIQESP
OrthoDBi592933at2759
PhylomeDBiQ02548
TreeFamiTF315397

Enzyme and pathway databases

PathwayCommonsiQ02548
ReactomeiR-HSA-8939245, RUNX1 regulates transcription of genes involved in BCR signaling
SignaLinkiQ02548
SIGNORiQ02548

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5079, 18 hits in 1063 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PAX5, human
EvolutionaryTraceiQ02548

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PAX5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5079
PharosiQ02548, Tbio

Protein Ontology

More...PROi		PR:Q02548
RNActiQ02548, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000196092, Expressed in buccal mucosa cell and 135 other tissues
ExpressionAtlasiQ02548, baseline and differential
GenevisibleiQ02548, HS

Family and domain databases

CDDicd00131, PAX, 1 hit
DisProtiDP00969
Gene3Di1.10.10.10, 2 hits
IDEALiIID00067
InterProiView protein in InterPro
IPR009057, Homeobox-like_sf
IPR043182, PAIRED_DNA-bd_dom
IPR001523, Paired_dom
IPR022130, Pax2_C
IPR043565, PAX_fam
IPR036388, WH-like_DNA-bd_sf
PANTHERiPTHR45636, PTHR45636, 1 hit
PfamiView protein in Pfam
PF00292, PAX, 1 hit
PF12403, Pax2_C, 1 hit
PRINTSiPR00027, PAIREDBOX
SMARTiView protein in SMART
SM00351, PAX, 1 hit
SUPFAMiSSF46689, SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS00034, PAIRED_1, 1 hit
PS51057, PAIRED_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAX5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q02548
Secondary accession number(s): A3QVP6
, A3QVP7, A3QVP8, C0KTF6, C0KTF7, C0KTF8, C0KTF9, C0KTG0, O75933, Q5SFM2, Q6S728, Q6S729, Q6S730, Q6S731, Q6S732
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: February 23, 2022
This is version 197 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again