Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 187 (13 Feb 2019)
Sequence version 3 (16 May 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transcription factor Sp3

Gene

SP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional factor that can act as an activator or repressor depending on isoform and/or post-translational modifications. Binds to GT and GC boxes promoter elements. Competes with SP1 for the GC-box promoters. Weak activator of transcription but can activate a number of genes involved in different processes such as cell-cycle regulation, hormone-induction and house-keeping.12 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri621 – 645C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri651 – 675C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri681 – 703C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3232118 SUMOylation of transcription factors

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q02447

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q02447

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor Sp3
Alternative name(s):
SPR-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172845.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11208 SP3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601804 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q02447

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi120K → R: Some loss of sumoylation. Slight increase in transcriptional activity. Large increase in transcriptional activity; when associated with R-551. 1 Publication1
Mutagenesisi551 – 553KEE → AAA: Increases transcriptional activity. 1 Publication3
Mutagenesisi551 – 553KEE → REA: 200-fold increase in transcriptional activation. 1 Publication3
Mutagenesisi551 – 553KEE → RED: 200-fold increase in transcriptional activation. 1 Publication3
Mutagenesisi551 – 552KE → RA: 200-fold increase in transcriptional activation. 2
Mutagenesisi551 – 552KE → RD: 200-fold increase in transcriptional activation. 2
Mutagenesisi551K → Q: A decreased interaction with HDAC1 and deacetylation of SP3. Increase of about 4.5% of activity of the TERT promoter. Decreased recruitment of HDAC1 and increased binding of RNA polymerase II with promoter DNA. 3 Publications1
Mutagenesisi551K → R: Great loss of sumoylation, 20-fold increase in transcriptional activity and diffuse nuclear localization. Further small increase in transcriptional activity; when associated with R-120. Increased interaction with HDAC1 and deacetylation of SP3. About 50% decrease in activity of the TERT promoter. Enhances recruitment of HDAC1 and inhibits binding of RNA polymerase II with promoter DNA. 3 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6670

Open Targets

More...
OpenTargetsi
ENSG00000172845

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36045

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SP3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
30923147

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471411 – 781Transcription factor Sp3Add BLAST781

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei73PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki120Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Modified residuei551N6-acetyllysine; alternate2 Publications1
Cross-linki551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei563PhosphoserineCombined sources1
Modified residuei566PhosphoserineBy similarity1
Cross-linki593Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei646PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Not glycosylated.
Acetylated by histone acetyltransferase p300, deacetylated by HDACs. Acetylation/deacetylation states regulate transcriptional activity. Acetylation appears to activate transcription. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. Ceramides can also regulate acetylation/deacetylation events through altering the interaction of HDAC with SP3. In vitro, C(18)-ceramides, but not C(16)-ceramides, increase the interaction of HDAC1 with SP3 and enhance the deacetylation of SP3 and the subsequent repression of the TERT promoter.7 Publications
Sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity.7 Publications

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q02447

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q02447

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q02447

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q02447

PeptideAtlas

More...
PeptideAtlasi
Q02447

PRoteomics IDEntifications database

More...
PRIDEi
Q02447

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58091
58092 [Q02447-2]
58093 [Q02447-3]
58094 [Q02447-4]
58095 [Q02447-5]
58096 [Q02447-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q02447

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q02447

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q02447

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172845 Expressed in 242 organ(s), highest expression level in amniotic fluid

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q02447 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q02447 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004580
HPA032145
HPA032146

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HLTF; the interaction may be required for basal transcriptional activity of HLTF. Interacts with HDAC1; the interaction deacetylates SP3 and regulates its transcriptional activity. Interacts with HDAC2 (preferably the CK2-phosphorylated form); the interaction deacetylates SP3 and regulates its transcriptional activity. Interacts with MEIS2 isoform 4 and PBX1 isoform PBX1a.5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ESR1P033722EBI-348158,EBI-78473

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112553, 43 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q02447

Protein interaction database and analysis system

More...
IntActi
Q02447, 13 interactors

Molecular INTeraction database

More...
MINTi
Q02447

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000310301

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q02447

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q02447

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni138 – 237Transactivation domain (Gln-rich)Add BLAST100
Regioni350 – 499Transactivation domain (Gln-rich)Add BLAST150
Regioni534 – 620Repressor domainAdd BLAST87

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi21 – 31Poly-GlyAdd BLAST11
Compositional biasi35 – 39Poly-Gln5
Compositional biasi44 – 100Ala-richAdd BLAST57

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri621 – 645C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri651 – 675C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri681 – 703C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155099

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG008933

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q02447

KEGG Orthology (KO)

More...
KOi
K09193

Identification of Orthologs from Complete Genome Data

More...
OMAi
IAQQTIH

Database of Orthologous Groups

More...
OrthoDBi
1085860at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q02447

TreeFam database of animal gene trees

More...
TreeFami
TF350150

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030452 SP3
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...
PANTHERi
PTHR23235:SF3 PTHR23235:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q02447-1) [UniParc]FASTAAdd to basket
Also known as: Large, L-Sp3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTAPEKPVKQ EEMAALDVDS GGGGGGGGGH GEYLQQQQQH GNGAVAAAAA
60 70 80 90 100
AQDTQPSPLA LLAATCSKIG PPSPGDDEEE AAAAAGAPAA AGATGDLASA
110 120 130 140 150
QLGGAPNRWE VLSATPTTIK DEAGNLVQIP SAATSSGQYV LPLQNLQNQQ
160 170 180 190 200
IFSVAPGSDS SNGTVSSVQY QVIPQIQSAD GQQVQIGFTG SSDNGGINQE
210 220 230 240 250
SSQIQIIPGS NQTLLASGTP SANIQNLIPQ TGQVQVQGVA IGGSSFPGQT
260 270 280 290 300
QVVANVPLGL PGNITFVPIN SVDLDSLGLS GSSQTMTAGI NADGHLINTG
310 320 330 340 350
QAMDSSDNSE RTGERVSPDI NETNTDTDLF VPTSSSSQLP VTIDSTGILQ
360 370 380 390 400
QNTNSLTTSS GQVHSSDLQG NYIQSPVSEE TQAQNIQVST AQPVVQHLQL
410 420 430 440 450
QESQQPTSQA QIVQGITPQT IHGVQASGQN ISQQALQNLQ LQLNPGTFLI
460 470 480 490 500
QAQTVTPSGQ VTWQTFQVQG VQNLQNLQIQ NTAAQQITLT PVQTLTLGQV
510 520 530 540 550
AAGGAFTSTP VSLSTGQLPN LQTVTVNSID SAGIQLHPGE NADSPADIRI
560 570 580 590 600
KEEEPDPEEW QLSGDSTLNT NDLTHLRVQV VDEEGDQQHQ EGKRLRRVAC
610 620 630 640 650
TCPNCKEGGG RGTNLGKKKQ HICHIPGCGK VYGKTSHLRA HLRWHSGERP
660 670 680 690 700
FVCNWMYCGK RFTRSDELQR HRRTHTGEKK FVCPECSKRF MRSDHLAKHI
710 720 730 740 750
KTHQNKKGIH SSSTVLASVE AARDDTLITA GGTTLILANI QQGSVSGIGT
760 770 780
VNTSATSNQD ILTNTEIPLQ LVTVSGNETM E
Length:781
Mass (Da):81,925
Last modified:May 16, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDCFD4363509DB49D
GO
Isoform 2 (identifier: Q02447-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.

Note: Produced by alternative initiation at Met-13 of isoform 1. No experimental confirmation available.
Show »
Length:769
Mass (Da):80,557
Checksum:iC02D0B852BBF9389
GO
Isoform 3 (identifier: Q02447-3) [UniParc]FASTAAdd to basket
Also known as: M1-Sp3

The sequence of this isoform differs from the canonical sequence as follows:
     1-285: Missing.

Note: Produced by alternative initiation at Met-286 of isoform 1. No experimental confirmation available.
Show »
Length:496
Mass (Da):53,715
Checksum:i65658E7F04158661
GO
Isoform 4 (identifier: Q02447-4) [UniParc]FASTAAdd to basket
Also known as: M2-Sp3

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.

Note: Produced by alternative initiation at Met-303 of isoform 1. No experimental confirmation available.
Show »
Length:479
Mass (Da):52,050
Checksum:iDA04C2A90DFA307A
GO
Isoform 5 (identifier: Q02447-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKI → M

Note: Produced by alternative splicing. An AUA codon is translated into Met and used as a translation initiation site (in vitro).
Show »
Length:713
Mass (Da):75,330
Checksum:iB0CF8FC66DA30478
GO
Isoform 6 (identifier: Q02447-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.
     53-93: Missing.

Note: Produced by alternative splicing.
Show »
Length:728
Mass (Da):76,814
Checksum:iE9D95D6717E9F885
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y6K5H0Y6K5_HUMAN
Transcription factor Sp3
SP3
713Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7L6H0Y7L6_HUMAN
Transcription factor Sp3
SP3
738Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti69I → M in AAR30505 (PubMed:15474306).Curated1
Sequence conflicti71P → G in AAA36630 (Ref. 7) Curated1
Sequence conflicti739N → K in AAL58086 (PubMed:12297010).Curated1
Sequence conflicti739N → K in AAR30505 (PubMed:15474306).Curated1
Sequence conflicti739N → K in AAR30506 (PubMed:15474306).Curated1
Sequence conflicti739N → K in CAA48562 (PubMed:1341900).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_016123164T → A3 PublicationsCorresponds to variant dbSNP:rs1047640Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0266981 – 302Missing in isoform 4. CuratedAdd BLAST302
Alternative sequenceiVSP_0266991 – 285Missing in isoform 3. CuratedAdd BLAST285
Alternative sequenceiVSP_0267001 – 69MTAPE…TCSKI → M in isoform 5. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0267011 – 12Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_02670253 – 93Missing in isoform 6. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY070137 mRNA Translation: AAL58086.1
AY441957 mRNA Translation: AAR30505.1
AY441958 mRNA Translation: AAR30506.1
AK304199 mRNA Translation: BAG65079.1
BC126414 mRNA Translation: AAI26415.1
AF494280 Genomic DNA Translation: AAM12875.1
AJ310752 mRNA Translation: CAC34575.1
M97191 mRNA Translation: AAA36630.2
X68560 mRNA Translation: CAA48562.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2254.1 [Q02447-1]
CCDS46452.1 [Q02447-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
B44489

NCBI Reference Sequences

More...
RefSeqi
NP_001017371.3, NM_001017371.4 [Q02447-5]
NP_001166183.1, NM_001172712.1
NP_003102.1, NM_003111.4 [Q02447-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.531587

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000310015; ENSP00000310301; ENSG00000172845 [Q02447-1]
ENST00000640958; ENSP00000492253; ENSG00000172845 [Q02447-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6670

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6670

UCSC genome browser

More...
UCSCi
uc002uig.3 human [Q02447-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY070137 mRNA Translation: AAL58086.1
AY441957 mRNA Translation: AAR30505.1
AY441958 mRNA Translation: AAR30506.1
AK304199 mRNA Translation: BAG65079.1
BC126414 mRNA Translation: AAI26415.1
AF494280 Genomic DNA Translation: AAM12875.1
AJ310752 mRNA Translation: CAC34575.1
M97191 mRNA Translation: AAA36630.2
X68560 mRNA Translation: CAA48562.1
CCDSiCCDS2254.1 [Q02447-1]
CCDS46452.1 [Q02447-5]
PIRiB44489
RefSeqiNP_001017371.3, NM_001017371.4 [Q02447-5]
NP_001166183.1, NM_001172712.1
NP_003102.1, NM_003111.4 [Q02447-1]
UniGeneiHs.531587

3D structure databases

ProteinModelPortaliQ02447
SMRiQ02447
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112553, 43 interactors
ELMiQ02447
IntActiQ02447, 13 interactors
MINTiQ02447
STRINGi9606.ENSP00000310301

PTM databases

iPTMnetiQ02447
PhosphoSitePlusiQ02447

Polymorphism and mutation databases

BioMutaiSP3
DMDMi30923147

Proteomic databases

EPDiQ02447
jPOSTiQ02447
MaxQBiQ02447
PaxDbiQ02447
PeptideAtlasiQ02447
PRIDEiQ02447
ProteomicsDBi58091
58092 [Q02447-2]
58093 [Q02447-3]
58094 [Q02447-4]
58095 [Q02447-5]
58096 [Q02447-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6670
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000310015; ENSP00000310301; ENSG00000172845 [Q02447-1]
ENST00000640958; ENSP00000492253; ENSG00000172845 [Q02447-5]
GeneIDi6670
KEGGihsa:6670
UCSCiuc002uig.3 human [Q02447-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6670
DisGeNETi6670
EuPathDBiHostDB:ENSG00000172845.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SP3
HGNCiHGNC:11208 SP3
HPAiCAB004580
HPA032145
HPA032146
MIMi601804 gene
neXtProtiNX_Q02447
OpenTargetsiENSG00000172845
PharmGKBiPA36045

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000155099
HOVERGENiHBG008933
InParanoidiQ02447
KOiK09193
OMAiIAQQTIH
OrthoDBi1085860at2759
PhylomeDBiQ02447
TreeFamiTF350150

Enzyme and pathway databases

ReactomeiR-HSA-3232118 SUMOylation of transcription factors
SignaLinkiQ02447
SIGNORiQ02447

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SP3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Sp3_transcription_factor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6670
PMAP-CutDBiQ02447

Protein Ontology

More...
PROi
PR:Q02447

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172845 Expressed in 242 organ(s), highest expression level in amniotic fluid
ExpressionAtlasiQ02447 baseline and differential
GenevisibleiQ02447 HS

Family and domain databases

InterProiView protein in InterPro
IPR030452 SP3
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PANTHERiPTHR23235:SF3 PTHR23235:SF3, 1 hit
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSP3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q02447
Secondary accession number(s): A0AVL9
, B4E2B7, Q69B26, Q69B27, Q8TD56, Q8WWU4, Q9BQR1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: May 16, 2003
Last modified: February 13, 2019
This is version 187 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again