Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (08 May 2019)
Sequence version 2 (16 May 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ankyrin-1

Gene

Ank1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions. In skeletal muscle, isoform Mu7 together with obscurin may provide a molecular link between the sarcoplasmic reticulum and myofibrils.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-445095 Interaction between L1 and Ankyrins
R-MMU-447043 Neurofascin interactions
R-MMU-6807878 COPI-mediated anterograde transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin-1
Short name:
ANK-1
Alternative name(s):
Erythrocyte ankyrin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ank1
Synonyms:Ank-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:88024 Ank1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Membrane, Sarcoplasmic reticulum

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000668841 – 1862Ankyrin-1Add BLAST1862

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei101(3S)-3-hydroxyasparagine; by HIF1AN; partial1 Publication1
Modified residuei229(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei425PhosphoserineBy similarity1
Modified residuei427(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei460(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei625(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei658(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei691(3S)-3-hydroxyaspartate; by HIF1ANBy similarity1
Modified residuei724(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei755PhosphoserineBy similarity1
Modified residuei757(3S)-3-hydroxyasparagine; by HIF1ANBy similarity1
Modified residuei777PhosphoserineCombined sources1
Modified residuei813PhosphoserineCombined sources1
Modified residuei830PhosphoserineBy similarity1
Modified residuei852PhosphoserineCombined sources1
Modified residuei862PhosphothreonineCombined sources1
Modified residuei957PhosphothreonineCombined sources1
Modified residuei1069PhosphotyrosineCombined sources1
Modified residuei1078PhosphoserineCombined sources1
Modified residuei1374PhosphothreonineBy similarity1
Modified residuei1376PhosphothreonineBy similarity1
Modified residuei1386PhosphoserineCombined sources1
Modified residuei1388PhosphoserineCombined sources1
Modified residuei1396PhosphothreonineCombined sources1
Modified residuei1424PhosphoserineCombined sources1
Modified residuei1473PhosphoserineCombined sources1
Modified residuei1482PhosphoserineCombined sources1
Modified residuei1519PhosphoserineBy similarity1
Modified residuei1529PhosphoserineBy similarity1
Modified residuei1612PhosphoserineCombined sources1
Modified residuei1660PhosphoserineBy similarity1
Modified residuei1675PhosphoserineBy similarity1
Modified residuei1685PhosphoserineBy similarity1
Isoform Mu7 (identifier: Q02357-7)
Modified residuei55PhosphoserineCombined sources1
Isoform Mu8 (identifier: Q02357-8)
Modified residuei55PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Regulated by phosphorylation.By similarity
Acylated by palmitic acid group(s).By similarity
Hydroxylated by HIF1AN at several asparagine and 1 aspartate residue within ANK repeat region; hydroxylation seems to increase the conformational stability of this region and may also modulate protein-protein interactions mediated by the ANK repeat region.By similarity

Keywords - PTMi

Hydroxylation, Lipoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q02357

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q02357

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q02357

PeptideAtlas

More...
PeptideAtlasi
Q02357

PRoteomics IDEntifications database

More...
PRIDEi
Q02357

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q02357

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q02357

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q02357

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000031543 Expressed in 219 organ(s), highest expression level in cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q02357 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q02357 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with a number of integral membrane proteins and cytoskeletal proteins. Interacts (via N-terminus) with SPTB/spectrin (beta chain). Interacts (via N-terminus ANK repeats) with SLC4A1/erythrocyte membrane protein band 3 (via cytoplasmic N-terminus). Also interacts with TTN/titin. Isoform Mu17 interacts with OBSCN isoform 3/obscurin. Interacts with HIF1AN (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q02357, 4 interactors

Molecular INTeraction database

More...
MINTi
Q02357

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000113571

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q02357

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati40 – 69ANK 1Add BLAST30
Repeati73 – 102ANK 2Add BLAST30
Repeati106 – 135ANK 3Add BLAST30
Repeati139 – 168ANK 4Add BLAST30
Repeati170 – 197ANK 5Add BLAST28
Repeati201 – 230ANK 6Add BLAST30
Repeati234 – 263ANK 7Add BLAST30
Repeati267 – 296ANK 8Add BLAST30
Repeati300 – 329ANK 9Add BLAST30
Repeati333 – 362ANK 10Add BLAST30
Repeati366 – 395ANK 11Add BLAST30
Repeati399 – 428ANK 12Add BLAST30
Repeati432 – 461ANK 13Add BLAST30
Repeati465 – 494ANK 14Add BLAST30
Repeati498 – 527ANK 15Add BLAST30
Repeati531 – 560ANK 16Add BLAST30
Repeati564 – 593ANK 17Add BLAST30
Repeati597 – 626ANK 18Add BLAST30
Repeati630 – 659ANK 19Add BLAST30
Repeati663 – 692ANK 20Add BLAST30
Repeati696 – 725ANK 21Add BLAST30
Repeati729 – 758ANK 22Add BLAST30
Repeati762 – 791ANK 23Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini909 – 1064ZU5 1PROSITE-ProRule annotationAdd BLAST156
Domaini1066 – 1212ZU5 2PROSITE-ProRule annotationAdd BLAST147
Domaini1399 – 1483DeathPROSITE-ProRule annotationAdd BLAST85

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 82789 kDa domainAdd BLAST827
Regioni1197 – 1331UPA domainBy similarityAdd BLAST135
Regioni1387 – 186255 kDa regulatory domainAdd BLAST476

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The 55 kDa regulatory domain is involved in regulating binding of SPTB/spectrin (beta chain) and SLC4A1/erythrocyte membrane protein band 3.By similarity
The ANK repeat region forms a spiral around a large central cavity and is involved in binding of ion transporters.By similarity
The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin (By similarity).By similarity

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4177 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155760

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q02357

KEGG Orthology (KO)

More...
KOi
K10380

Database of Orthologous Groups

More...
OrthoDBi
1011028at2759

TreeFam database of animal gene trees

More...
TreeFami
TF351263

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 7 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR040745 Ankyrin_UPA
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR000906 ZU5_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 9 hits
PF00531 Death, 1 hit
PF17809 UPA_2, 1 hit
PF00791 ZU5, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 23 hits
SM00005 DEATH, 1 hit
SM00218 ZU5, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit
SSF48403 SSF48403, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 20 hits
PS50017 DEATH_DOMAIN, 1 hit
PS51145 ZU5, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform Er1 (identifier: Q02357-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGFCKADAAT SFLRAARSGN LDKALDHLRN GVDINTCNQN GLNGLHLASK
60 70 80 90 100
EGHVKMVVEL LHKEIILETT TKKGNTALHI AALAGQDEVV RELVNYGANV
110 120 130 140 150
NAQSQKGFTP LYMAAQENHL EVVKFLLENG ANQNVATEDG FTPLAVALQQ
160 170 180 190 200
GHENVVAHLI NYGTKGKVRL PALHIAARND DTRTAAVLLQ NDPNPDVLSK
210 220 230 240 250
TGFTPLHIAA HYENLNVAQL LLNRGASVNF TPQNGITPLH IASRRGNVIM
260 270 280 290 300
VRLLLDRGAQ IETRTKDELT PLHCAARNGH VRISEILLDH GAPIQAKTKN
310 320 330 340 350
GLSPIHMAAQ GDHLDCVRLL LQYNAEIDDI TLDHLTPLHV AAHCGHHRVA
360 370 380 390 400
KVLLDKGAKP NSRALNGFTP LHIACKKNHI RVMELLLKTG ASIDAVTESG
410 420 430 440 450
LTPLHVASFM GHLPIVKNLL QRGASPNVSN VKVETPLHMA ARAGHTEVAK
460 470 480 490 500
YLLQNKAKAN AKAKDDQTPL HCAARIGHTG MVKLLLENGA SPNLATTAGH
510 520 530 540 550
TPLHTAAREG HVDTALALLE KEASQACMTK KGFTPLHVAA KYGKVRLAEL
560 570 580 590 600
LLEHDAHPNA AGKNGLTPLH VAVHHNNLDI VKLLLPRGGS PHSPAWNGYT
610 620 630 640 650
PLHIAAKQNQ IEVARSLLQY GGSANAESVQ GVTPLHLAAQ EGHTEMVALL
660 670 680 690 700
LSKQANGNLG NKSGLTPLHL VSQEGHVPVA DVLIKHGVTV DATTRMGYTP
710 720 730 740 750
LHVASHYGNI KLVKFLLQHQ ADVNAKTKLG YSPLHQAAQQ GHTDIVTLLL
760 770 780 790 800
KNGASPNEVS SNGTTPLAIA KRLGYISVTD VLKVVTDETS VVLVSDKHRM
810 820 830 840 850
SYPETVDEIL DVSEDEGDEL VGSKAERRDS RDVGEEKELL DFVPKLDQVV
860 870 880 890 900
ESPAIPRIPC VTPETVVIRS EDQEQASKEY DEDSLIPSSP ATETSDNISP
910 920 930 940 950
VASPVHTGFL VSFMVDARGG SMRGSRHNGL RVVIPPRTCA APTRITCRLV
960 970 980 990 1000
KPQKLNTPPP LAEEEGLASR IIALGPTGAQ FLSPVIVEIP HFASHGRGDR
1010 1020 1030 1040 1050
ELVVLRSENG SVWKEHKSRY GESYLDQILN GMDEELGSLE ELEKKRVCRI
1060 1070 1080 1090 1100
ITTDFPLYFV IMSRLCQDYD TIGPEGGSLR SKLVPLVQAT FPENAVTKKV
1110 1120 1130 1140 1150
KLALQAQPVP DELVTKLLGN QATFSPIVTV EPRRRKFHRP IGLRIPLPPS
1160 1170 1180 1190 1200
WTDNPRDSGE GDTTSLRLLC SVIGGTDQAQ WEDITGTTKL IYANECANFT
1210 1220 1230 1240 1250
TNVSARFWLS DCPRTAEAVH FATLLYKELT AVPYMAKFVI FAKMNDAREG
1260 1270 1280 1290 1300
RLRCYCMTDD KVDKTLEQHE NFVEVARSRD IEVLEGMPLF AELSGNLVPV
1310 1320 1330 1340 1350
KKAAQQRSFH FQSFRENRLA IPVKVRDSSR EPGGFLSFLR KTMKYEDTQH
1360 1370 1380 1390 1400
ILCHLNITMP PCTKGSGAED RRRTLTPLTL RYSILSESRL GFTSDTDRVE
1410 1420 1430 1440 1450
MRMAVIREHL GLSWAELARE LQFSVEDINR IRVENPNSLL DQSTALLTLW
1460 1470 1480 1490 1500
VDREGENAKM ENLYTALRNI DRSEIVNMLE GSGRQSRNLK PERRHGDREY
1510 1520 1530 1540 1550
SLSPSQVNGY SSLQDELLSP ASLQYALPSP LCADQYWNEV TVIDAIPLAA
1560 1570 1580 1590 1600
TEHDTMLEMS DMQVWSAGLT PSLVTAEDSS LECSKAEDSD AIPEWKLEGA
1610 1620 1630 1640 1650
HSEDTQGPEL GSQDLVEDDT VDSDATNGLA DLLGQEEGQR SEKKRQEVSG
1660 1670 1680 1690 1700
TEQDTETEVS LVSGQQRVHA RITDSPSVRQ VLDRSQARTL DWDKQGSTAV
1710 1720 1730 1740 1750
HPQEATQSSW QEEVTQGPHS FQRRITTIQG PEPGALQEYE QVLVSTREHV
1760 1770 1780 1790 1800
QRGPPETGSP KAGKEPSLWA PESAFSQEVQ GDELQNIPGE QVTEEQFTDE
1810 1820 1830 1840 1850
QGNIVTKKII RKVVRQVDSS GAIDTQQHEE VELRGSGLQP DLIEGRKGAQ
1860
IVKRASLKRG KQ
Note: Produced by alternative promoter usage.
Length:1,862
Mass (Da):204,227
Last modified:May 16, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB5F3EBB447C3485D
GO
Isoform Br2 (identifier: Q02357-2) [UniParc]FASTAAdd to basket
Also known as: Cb14/11

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MGFCK → MAERPRRSGSDPA
     817-817: G → GTAHISIMG
     1636-1665: Missing.

Note: Produced by alternative splicing of isoform Er1.
Show »
Length:1,848
Mass (Da):202,549
Checksum:iBF5A6FAA4DE9071A
GO
Isoform Er3 (identifier: Q02357-3) [UniParc]FASTAAdd to basket
Also known as: Er18

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP

Note: Incomplete sequence. Produced by alternative splicing of isoform Er1.
Show »
Length:1,863
Mass (Da):204,290
Checksum:i54B9C9F6E47ECB68
GO
Isoform Br4 (identifier: Q02357-4) [UniParc]FASTAAdd to basket
Also known as: Cb12

The sequence of this isoform differs from the canonical sequence as follows:
     1831-1831: V → VIVEGPLADPGDLEADIESFMKLTKV

Note: Incomplete sequence. Produced by alternative splicing of isoform Er1.
Show »
Length:1,887
Mass (Da):206,897
Checksum:i1D67DB304BEE32D5
GO
Isoform 5 (identifier: Q02357-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK
     1510-1664: Missing.

Note: Produced by alternative splicing of isoform Er1.
Show »
Length:1,744
Mass (Da):192,033
Checksum:i86F90F57AF6707A4
GO
Isoform 6 (identifier: Q02357-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK
     817-817: G → GTAHISIMG

Note: Produced by alternative splicing of isoform Er1.
Show »
Length:1,907
Mass (Da):209,548
Checksum:i1BFB9FEE0C5CCFAC
GO
Isoform Mu7 (identifier: Q02357-7) [UniParc]FASTAAdd to basket
Also known as: skAnk1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1707: Missing.
     1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK

Note: Produced by alternative promoter usage.Combined sources
Show »
Length:155
Mass (Da):17,539
Checksum:i304B0AC409407EA1
GO
Isoform Mu8 (identifier: Q02357-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1707: Missing.
     1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK
     1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP

Note: Produced by alternative splicing of isoform Mu7.Combined sources
Show »
Length:156
Mass (Da):17,602
Checksum:iC67C71179430485E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J1N7A0A0R4J1N7_MOUSE
Ankyrin-1
Ank1
1,907Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QNT8E9QNT8_MOUSE
Ankyrin-1
Ank1
1,862Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z5M4D3Z5M4_MOUSE
Ankyrin-1
Ank1
1,883Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YTV8D3YTV8_MOUSE
Ankyrin-1
Ank1
1,878Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q0VGY9Q0VGY9_MOUSE
Ank1 protein
Ank1
1,887Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E8J2G5E8J2_MOUSE
Ankyrin 1, erythroid
Ank1 mCG_140342
1,848Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZW98B7ZW98_MOUSE
Ank1 protein
Ank1
1,852Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G8JL84G8JL84_MOUSE
Ankyrin-1
Ank1
1,863Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7D1P5F7D1P5_MOUSE
Ankyrin-1
Ank1
1,098Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJ51D6RJ51_MOUSE
Ankyrin-1
Ank1
572Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti507A → T in BAE34375 (PubMed:9628825).Curated1
Sequence conflicti678P → L in AAA37236 (PubMed:1386265).Curated1
Sequence conflicti818D → G in BAE34375 (PubMed:9628825).Curated1
Sequence conflicti1098K → N in CAA48801 (PubMed:8486643).Curated1
Sequence conflicti1481G → V in CAA48801 (PubMed:8486643).Curated1
Sequence conflicti1541T → A in BAE27815 (PubMed:9628825).Curated1
Sequence conflicti1541T → A in BAE28015 (PubMed:9628825).Curated1
Sequence conflicti1644K → R in BAE28015 (PubMed:9628825).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0184521 – 1707Missing in isoform Mu7 and isoform Mu8. 3 PublicationsAdd BLAST1707
Alternative sequenceiVSP_0184531 – 5MGFCK → MAERPRRSGSDPA in isoform Br2. 2 Publications5
Alternative sequenceiVSP_0184541 – 4MGFC → MAQAAKQLKKIKDIEAQALQ EQKEKEESNRKRRNRSRDRK K in isoform 5 and isoform 6. 1 Publication4
Alternative sequenceiVSP_018455817G → GTAHISIMG in isoform Br2 and isoform 6. 2 Publications1
Alternative sequenceiVSP_0184561510 – 1664Missing in isoform 5. 1 PublicationAdd BLAST155
Alternative sequenceiVSP_0184571636 – 1665Missing in isoform Br2. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_0184581708 – 1780SSWQE…SQEVQ → MWTFITQLLVTLVLLGFFLV SCQNVMHIVKGSLCFVLKHI HQELDKELGESEGLSDDEET ISTRVVRRRVFLK in isoform Mu7 and isoform Mu8. 3 PublicationsAdd BLAST73
Alternative sequenceiVSP_0184591831V → VIVEGPLADPGDLEADIESF MKLTKV in isoform Br4. 1 Publication1
Alternative sequenceiVSP_0184601832 – 1862ELRGS…KRGKQ → IVEGPLADPGDLEADIESFM KLTKDHTSTPKP in isoform Er3 and isoform Mu8. 2 PublicationsAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M84756 mRNA Translation: AAA37236.1
X69063 mRNA Translation: CAA48801.1
X69064 mRNA Translation: CAA48802.1
U73972 mRNA Translation: AAC24156.1
AK134267 mRNA Translation: BAE22074.1
AK147278 mRNA Translation: BAE27815.1
AK147597 mRNA Translation: BAE28015.1
AK158131 mRNA Translation: BAE34375.1
BC061219 mRNA Translation: AAH61219.1
U76758 Genomic DNA Translation: AAB37323.1
U76758 Genomic DNA Translation: AAB37324.1
U76758 Genomic DNA Translation: AAB37325.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS22187.1 [Q02357-2]
CCDS52523.1 [Q02357-6]
CCDS72099.1 [Q02357-5]
CCDS72100.1 [Q02357-1]
CCDS72101.1 [Q02357-4]
CCDS80864.1 [Q02357-7]
CCDS80865.1 [Q02357-8]

Protein sequence database of the Protein Information Resource

More...
PIRi
I49502
S37771
S37772

NCBI Reference Sequences

More...
RefSeqi
NP_001104253.1, NM_001110783.3
NP_001264209.1, NM_001277280.2 [Q02357-5]
NP_001264210.1, NM_001277281.2
NP_001264215.1, NM_001277286.2
NP_001264218.1, NM_001277289.2
NP_001297365.1, NM_001310436.1 [Q02357-8]
NP_001297366.1, NM_001310437.1 [Q02357-7]
NP_112435.2, NM_031158.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000033947; ENSMUSP00000033947; ENSMUSG00000031543 [Q02357-8]
ENSMUST00000110688; ENSMUSP00000106316; ENSMUSG00000031543 [Q02357-5]
ENSMUST00000121075; ENSMUSP00000112966; ENSMUSG00000031543 [Q02357-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11733

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:11733

UCSC genome browser

More...
UCSCi
uc009lee.3 mouse [Q02357-6]
uc009lef.3 mouse [Q02357-5]
uc009lel.2 mouse [Q02357-7]
uc009lem.2 mouse [Q02357-8]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84756 mRNA Translation: AAA37236.1
X69063 mRNA Translation: CAA48801.1
X69064 mRNA Translation: CAA48802.1
U73972 mRNA Translation: AAC24156.1
AK134267 mRNA Translation: BAE22074.1
AK147278 mRNA Translation: BAE27815.1
AK147597 mRNA Translation: BAE28015.1
AK158131 mRNA Translation: BAE34375.1
BC061219 mRNA Translation: AAH61219.1
U76758 Genomic DNA Translation: AAB37323.1
U76758 Genomic DNA Translation: AAB37324.1
U76758 Genomic DNA Translation: AAB37325.1
CCDSiCCDS22187.1 [Q02357-2]
CCDS52523.1 [Q02357-6]
CCDS72099.1 [Q02357-5]
CCDS72100.1 [Q02357-1]
CCDS72101.1 [Q02357-4]
CCDS80864.1 [Q02357-7]
CCDS80865.1 [Q02357-8]
PIRiI49502
S37771
S37772
RefSeqiNP_001104253.1, NM_001110783.3
NP_001264209.1, NM_001277280.2 [Q02357-5]
NP_001264210.1, NM_001277281.2
NP_001264215.1, NM_001277286.2
NP_001264218.1, NM_001277289.2
NP_001297365.1, NM_001310436.1 [Q02357-8]
NP_001297366.1, NM_001310437.1 [Q02357-7]
NP_112435.2, NM_031158.4

3D structure databases

SMRiQ02357
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ02357, 4 interactors
MINTiQ02357
STRINGi10090.ENSMUSP00000113571

PTM databases

iPTMnetiQ02357
PhosphoSitePlusiQ02357
SwissPalmiQ02357

Proteomic databases

jPOSTiQ02357
MaxQBiQ02357
PaxDbiQ02357
PeptideAtlasiQ02357
PRIDEiQ02357

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033947; ENSMUSP00000033947; ENSMUSG00000031543 [Q02357-8]
ENSMUST00000110688; ENSMUSP00000106316; ENSMUSG00000031543 [Q02357-5]
ENSMUST00000121075; ENSMUSP00000112966; ENSMUSG00000031543 [Q02357-7]
GeneIDi11733
KEGGimmu:11733
UCSCiuc009lee.3 mouse [Q02357-6]
uc009lef.3 mouse [Q02357-5]
uc009lel.2 mouse [Q02357-7]
uc009lem.2 mouse [Q02357-8]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
286
MGIiMGI:88024 Ank1

Phylogenomic databases

eggNOGiKOG4177 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000155760
InParanoidiQ02357
KOiK10380
OrthoDBi1011028at2759
TreeFamiTF351263

Enzyme and pathway databases

ReactomeiR-MMU-445095 Interaction between L1 and Ankyrins
R-MMU-447043 Neurofascin interactions
R-MMU-6807878 COPI-mediated anterograde transport

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q02357

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000031543 Expressed in 219 organ(s), highest expression level in cerebellum
ExpressionAtlasiQ02357 baseline and differential
GenevisibleiQ02357 MM

Family and domain databases

CDDicd00204 ANK, 7 hits
Gene3Di1.25.40.20, 3 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR040745 Ankyrin_UPA
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR000906 ZU5_dom
PfamiView protein in Pfam
PF12796 Ank_2, 9 hits
PF00531 Death, 1 hit
PF17809 UPA_2, 1 hit
PF00791 ZU5, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 23 hits
SM00005 DEATH, 1 hit
SM00218 ZU5, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF48403 SSF48403, 2 hits
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 20 hits
PS50017 DEATH_DOMAIN, 1 hit
PS51145 ZU5, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANK1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q02357
Secondary accession number(s): P70440
, P97446, P97941, Q3TZ35, Q3UH42, Q3UHP2, Q3UYY7, Q61302, Q61303, Q78E45
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: May 16, 2006
Last modified: May 8, 2019
This is version 168 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again