Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q02223 (TNR17_HUMAN)

Entry version 196 (07 Apr 2021)
Sequence version 2 (30 Nov 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Tumor necrosis factor receptor superfamily member 17

Gene

TNFRSF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor activity Source: ProtInc
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q02223

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5669034, TNFs bind their physiological receptors

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q02223

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 17
Alternative name(s):
B-cell maturation protein
CD_antigen: CD269
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNFRSF17
Synonyms:BCM, BCMA
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11913, TNFRSF17

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		109545, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q02223

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000048462.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 54ExtracellularSequence analysisAdd BLAST54
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei55 – 77Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST23
Topological domaini78 – 184CytoplasmicSequence analysisAdd BLAST107

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei3 – 4Breakpoint for translocation to form IL2/TNFRSF17 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...DisGeNETi		608

Open Targets

More...OpenTargetsi		ENSG00000048462

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36606

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q02223, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB15719, Belantamab mafodotin

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1889

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TNFRSF17

Domain mapping of disease mutations (DMDM)

More...DMDMi		313104029

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000589351 – 184Tumor necrosis factor receptor superfamily member 17Add BLAST184

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi8 ↔ 212 Publications
Disulfide bondi24 ↔ 372 Publications
Disulfide bondi28 ↔ 412 Publications

Keywords - PTMi

Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q02223

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q02223

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q02223

PeptideAtlas

More...PeptideAtlasi		Q02223

PRoteomics IDEntifications database

More...PRIDEi		Q02223

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		58062 [Q02223-1]
61498

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q02223, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q02223

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q02223

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in mature B-cells, but not in T-cells or monocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000048462, Expressed in tonsil and 123 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q02223, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q02223, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000048462, Tissue enhanced (blood, intestine, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107080, 23 interactors

Protein interaction database and analysis system

More...IntActi		Q02223, 18 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000053243

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q02223, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q02223

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q02223

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q02223

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati7 – 41TNFR-CysAdd BLAST35

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502SF2N, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154485

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_131588_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q02223

Identification of Orthologs from Complete Genome Data

More...OMAi		CHLRCSN

Database of Orthologous Groups

More...OrthoDBi		1334921at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q02223

TreeFam database of animal gene trees

More...TreeFami		TF337842

Family and domain databases

Conserved Domains Database

More...CDDi		cd13414, TNFRSF17, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015337, BCMA_Tall-1-bd
IPR043521, TNFR_13C/17
IPR022320, TNFR_17

The PANTHER Classification System

More...PANTHERi		PTHR20437, PTHR20437, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09257, BCMA-Tall_bind, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF011859, BCMA_Tall-1_bd, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01967, TNFACTORR17

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q02223-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK 
        60         70         80         90        100
GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA 
       110        120        130        140        150
NIDLEKSRTG DEIILPRGLE YTVEECTCED CIKSKPKVDS DHCFPLPAME 
       160        170        180 
EGATILVTTK TNDYCKSLPA ALSATEIEKS ISAR
Length:184
Mass (Da):20,165
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB6D87B3685F66022
GO
Isoform 2 (identifier: Q02223-2) [UniParc]FASTAAdd to basket
Also known as: TV4

The sequence of this isoform differs from the canonical sequence as follows:
     44-93: SVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTG → R

Note: Observed only in some CD19+ cell.Curated
Show »
Length:135
Mass (Da):14,843
Checksum:iFC3D1DDBB1195989
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BMB5H3BMB5_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF17
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01875554A → V1 PublicationCorresponds to variant dbSNP:rs11570146Ensembl.1
Natural variantiVAR_01875665I → V1 PublicationCorresponds to variant dbSNP:rs11570147Ensembl.1
Natural variantiVAR_01875775F → V1 PublicationCorresponds to variant dbSNP:rs11570148EnsemblClinVar.1
Natural variantiVAR_01875881N → S5 PublicationsCorresponds to variant dbSNP:rs373496Ensembl.1
Natural variantiVAR_012234153A → T1 PublicationCorresponds to variant dbSNP:rs150352299Ensembl.1
Natural variantiVAR_018759165C → S1 PublicationCorresponds to variant dbSNP:rs11570159Ensembl.1
Natural variantiVAR_061855176E → D. Corresponds to variant dbSNP:rs34546237EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04767844 – 93SVTNS…FKNTG → R in isoform 2. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z14954 mRNA Translation: CAA78679.1
Z29574 Genomic DNA Translation: CAA82690.1
Z29575 mRNA Translation: CAA82691.1
AB052772 Genomic DNA Translation: BAB60895.1
EF152355 mRNA Translation: ABN42510.1
AY684975 mRNA Translation: AAV92616.1
AY509112 Genomic DNA Translation: AAR84240.1
U95742 Genomic DNA Translation: AAB67251.1
AC007216 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10552.1 [Q02223-1]

Protein sequence database of the Protein Information Resource

More...PIRi		S43486

NCBI Reference Sequences

More...RefSeqi		NP_001183.2, NM_001192.2 [Q02223-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000053243; ENSP00000053243; ENSG00000048462 [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462 [Q02223-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		608

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:608

UCSC genome browser

More...UCSCi		uc002dbv.3, human [Q02223-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z14954 mRNA Translation: CAA78679.1
Z29574 Genomic DNA Translation: CAA82690.1
Z29575 mRNA Translation: CAA82691.1
AB052772 Genomic DNA Translation: BAB60895.1
EF152355 mRNA Translation: ABN42510.1
AY684975 mRNA Translation: AAV92616.1
AY509112 Genomic DNA Translation: AAR84240.1
U95742 Genomic DNA Translation: AAB67251.1
AC007216 Genomic DNA No translation available.
CCDSiCCDS10552.1 [Q02223-1]
PIRiS43486
RefSeqiNP_001183.2, NM_001192.2 [Q02223-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OQDX-ray2.60K/L/M/N/O/P/Q/R8-46[»]
1XU2X-ray2.35R/S/T5-51[»]
2KN1NMR-A2-50[»]
4ZFOX-ray1.90F/K1-54[»]
6J7WX-ray2.60C/D6-44[»]
BMRBiQ02223
SMRiQ02223
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107080, 23 interactors
IntActiQ02223, 18 interactors
STRINGi9606.ENSP00000053243

Chemistry databases

DrugBankiDB15719, Belantamab mafodotin
GuidetoPHARMACOLOGYi1889

PTM databases

GlyGeniQ02223, 1 site
iPTMnetiQ02223
PhosphoSitePlusiQ02223

Genetic variation databases

BioMutaiTNFRSF17
DMDMi313104029

Proteomic databases

jPOSTiQ02223
MassIVEiQ02223
PaxDbiQ02223
PeptideAtlasiQ02223
PRIDEiQ02223
ProteomicsDBi58062 [Q02223-1]
61498

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q02223, 224 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		11568, 670 antibodies

The CPTC Antibody Portal

More...CPTCi		Q02223, 1 antibody

The DNASU plasmid repository

More...DNASUi		608

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462 [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462 [Q02223-2]
GeneIDi608
KEGGihsa:608
UCSCiuc002dbv.3, human [Q02223-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		608
DisGeNETi608

GeneCards: human genes, protein and diseases

More...GeneCardsi		TNFRSF17
HGNCiHGNC:11913, TNFRSF17
HPAiENSG00000048462, Tissue enhanced (blood, intestine, lymphoid tissue)
MIMi109545, gene
neXtProtiNX_Q02223
OpenTargetsiENSG00000048462
PharmGKBiPA36606
VEuPathDBiHostDB:ENSG00000048462.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502SF2N, Eukaryota
GeneTreeiENSGT00940000154485
HOGENOMiCLU_131588_0_0_1
InParanoidiQ02223
OMAiCHLRCSN
OrthoDBi1334921at2759
PhylomeDBiQ02223
TreeFamiTF337842

Enzyme and pathway databases

PathwayCommonsiQ02223
ReactomeiR-HSA-5669034, TNFs bind their physiological receptors
SIGNORiQ02223

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		608, 10 hits in 989 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TNFRSF17, human
EvolutionaryTraceiQ02223

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TNFRSF17

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		608
PharosiQ02223, Tbio

Protein Ontology

More...PROi		PR:Q02223
RNActiQ02223, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000048462, Expressed in tonsil and 123 other tissues
ExpressionAtlasiQ02223, baseline and differential
GenevisibleiQ02223, HS

Family and domain databases

CDDicd13414, TNFRSF17, 1 hit
InterProiView protein in InterPro
IPR015337, BCMA_Tall-1-bd
IPR043521, TNFR_13C/17
IPR022320, TNFR_17
PANTHERiPTHR20437, PTHR20437, 1 hit
PfamiView protein in Pfam
PF09257, BCMA-Tall_bind, 1 hit
PIRSFiPIRSF011859, BCMA_Tall-1_bd, 1 hit
PRINTSiPR01967, TNFACTORR17

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNR17_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q02223
Secondary accession number(s): Q2TQ40
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: November 30, 2010
Last modified: April 7, 2021
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again