Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 17

Gene

TNFRSF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.3 Publications

GO - Molecular functioni

  • signaling receptor activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiR-HSA-5669034 TNFs bind their physiological receptors
SIGNORiQ02223

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 17
Alternative name(s):
B-cell maturation protein
CD_antigen: CD269
Gene namesi
Name:TNFRSF17
Synonyms:BCM, BCMA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000048462.10
HGNCiHGNC:11913 TNFRSF17
MIMi109545 gene
neXtProtiNX_Q02223

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 54ExtracellularSequence analysisAdd BLAST54
Transmembranei55 – 77Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST23
Topological domaini78 – 184CytoplasmicSequence analysisAdd BLAST107

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei3 – 4Breakpoint for translocation to form IL2/TNFRSF17 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi608
OpenTargetsiENSG00000048462
PharmGKBiPA36606

Polymorphism and mutation databases

BioMutaiTNFRSF17
DMDMi313104029

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000589351 – 184Tumor necrosis factor receptor superfamily member 17Add BLAST184

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi8 ↔ 212 Publications
Disulfide bondi24 ↔ 372 Publications
Disulfide bondi28 ↔ 412 Publications

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ02223
PeptideAtlasiQ02223
PRIDEiQ02223
ProteomicsDBi58062

PTM databases

iPTMnetiQ02223
PhosphoSitePlusiQ02223

Expressioni

Tissue specificityi

Expressed in mature B-cells, but not in T-cells or monocytes.

Gene expression databases

BgeeiENSG00000048462 Expressed in 105 organ(s), highest expression level in spleen
CleanExiHS_TNFRSF17
ExpressionAtlasiQ02223 baseline and differential
GenevisibleiQ02223 HS

Interactioni

Subunit structurei

Associates with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6.2 Publications

Protein-protein interaction databases

BioGridi107080, 19 interactors
IntActiQ02223, 5 interactors
STRINGi9606.ENSP00000053243

Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ02223
SMRiQ02223
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ02223

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati7 – 41TNFR-CysAdd BLAST35

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IW7R Eukaryota
ENOG4111D91 LUCA
GeneTreeiENSGT00390000011914
HOGENOMiHOG000129926
HOVERGENiHBG062796
InParanoidiQ02223
KOiK05153
OMAiFPLPAME
OrthoDBiEOG091G0S5G
PhylomeDBiQ02223
TreeFamiTF337842

Family and domain databases

CDDicd13414 TNFRSF17, 1 hit
InterProiView protein in InterPro
IPR015337 BCMA_Tall-1-bd
IPR022320 TNFR_17
PfamiView protein in Pfam
PF09257 BCMA-Tall_bind, 1 hit
PIRSFiPIRSF011859 BCMA_Tall-1_bd, 1 hit
PRINTSiPR01967 TNFACTORR17

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q02223-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK
60 70 80 90 100
GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA
110 120 130 140 150
NIDLEKSRTG DEIILPRGLE YTVEECTCED CIKSKPKVDS DHCFPLPAME
160 170 180
EGATILVTTK TNDYCKSLPA ALSATEIEKS ISAR
Length:184
Mass (Da):20,165
Last modified:November 30, 2010 - v2
Checksum:iB6D87B3685F66022
GO
Isoform 2 (identifier: Q02223-2) [UniParc]FASTAAdd to basket
Also known as: TV4

The sequence of this isoform differs from the canonical sequence as follows:
     44-93: SVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTG → R

Note: Observed only in some CD19+ cell.
Show »
Length:135
Mass (Da):14,843
Checksum:iFC3D1DDBB1195989
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BMB5H3BMB5_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF17
133Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01875554A → V1 PublicationCorresponds to variant dbSNP:rs11570146Ensembl.1
Natural variantiVAR_01875665I → V1 PublicationCorresponds to variant dbSNP:rs11570147Ensembl.1
Natural variantiVAR_01875775F → V1 PublicationCorresponds to variant dbSNP:rs11570148Ensembl.1
Natural variantiVAR_01875881N → S5 PublicationsCorresponds to variant dbSNP:rs373496Ensembl.1
Natural variantiVAR_012234153A → T1 PublicationCorresponds to variant dbSNP:rs150352299Ensembl.1
Natural variantiVAR_018759165C → S1 PublicationCorresponds to variant dbSNP:rs11570159Ensembl.1
Natural variantiVAR_061855176E → D. Corresponds to variant dbSNP:rs34546237Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04767844 – 93SVTNS…FKNTG → R in isoform 2. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z14954 mRNA Translation: CAA78679.1
Z29574 Genomic DNA Translation: CAA82690.1
Z29575 mRNA Translation: CAA82691.1
AB052772 Genomic DNA Translation: BAB60895.1
EF152355 mRNA Translation: ABN42510.1
AY684975 mRNA Translation: AAV92616.1
AY509112 Genomic DNA Translation: AAR84240.1
U95742 Genomic DNA Translation: AAB67251.1
AC007216 Genomic DNA No translation available.
CCDSiCCDS10552.1 [Q02223-1]
PIRiS43486
RefSeqiNP_001183.2, NM_001192.2 [Q02223-1]
UniGeneiHs.2556

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462 [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462 [Q02223-2]
GeneIDi608
KEGGihsa:608
UCSCiuc002dbv.3 human [Q02223-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z14954 mRNA Translation: CAA78679.1
Z29574 Genomic DNA Translation: CAA82690.1
Z29575 mRNA Translation: CAA82691.1
AB052772 Genomic DNA Translation: BAB60895.1
EF152355 mRNA Translation: ABN42510.1
AY684975 mRNA Translation: AAV92616.1
AY509112 Genomic DNA Translation: AAR84240.1
U95742 Genomic DNA Translation: AAB67251.1
AC007216 Genomic DNA No translation available.
CCDSiCCDS10552.1 [Q02223-1]
PIRiS43486
RefSeqiNP_001183.2, NM_001192.2 [Q02223-1]
UniGeneiHs.2556

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OQDX-ray2.60K/L/M/N/O/P/Q/R8-46[»]
1XU2X-ray2.35R/S/T5-51[»]
2KN1NMR-A2-50[»]
4ZFOX-ray1.90F/K1-54[»]
ProteinModelPortaliQ02223
SMRiQ02223
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107080, 19 interactors
IntActiQ02223, 5 interactors
STRINGi9606.ENSP00000053243

PTM databases

iPTMnetiQ02223
PhosphoSitePlusiQ02223

Polymorphism and mutation databases

BioMutaiTNFRSF17
DMDMi313104029

Proteomic databases

PaxDbiQ02223
PeptideAtlasiQ02223
PRIDEiQ02223
ProteomicsDBi58062

Protocols and materials databases

DNASUi608
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462 [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462 [Q02223-2]
GeneIDi608
KEGGihsa:608
UCSCiuc002dbv.3 human [Q02223-1]

Organism-specific databases

CTDi608
DisGeNETi608
EuPathDBiHostDB:ENSG00000048462.10
GeneCardsiTNFRSF17
HGNCiHGNC:11913 TNFRSF17
MIMi109545 gene
neXtProtiNX_Q02223
OpenTargetsiENSG00000048462
PharmGKBiPA36606
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IW7R Eukaryota
ENOG4111D91 LUCA
GeneTreeiENSGT00390000011914
HOGENOMiHOG000129926
HOVERGENiHBG062796
InParanoidiQ02223
KOiK05153
OMAiFPLPAME
OrthoDBiEOG091G0S5G
PhylomeDBiQ02223
TreeFamiTF337842

Enzyme and pathway databases

ReactomeiR-HSA-5669034 TNFs bind their physiological receptors
SIGNORiQ02223

Miscellaneous databases

ChiTaRSiTNFRSF17 human
EvolutionaryTraceiQ02223
GeneWikiiTNFRSF17
GenomeRNAii608
PROiPR:Q02223
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000048462 Expressed in 105 organ(s), highest expression level in spleen
CleanExiHS_TNFRSF17
ExpressionAtlasiQ02223 baseline and differential
GenevisibleiQ02223 HS

Family and domain databases

CDDicd13414 TNFRSF17, 1 hit
InterProiView protein in InterPro
IPR015337 BCMA_Tall-1-bd
IPR022320 TNFR_17
PfamiView protein in Pfam
PF09257 BCMA-Tall_bind, 1 hit
PIRSFiPIRSF011859 BCMA_Tall-1_bd, 1 hit
PRINTSiPR01967 TNFACTORR17
ProtoNetiSearch...

Entry informationi

Entry nameiTNR17_HUMAN
AccessioniPrimary (citable) accession number: Q02223
Secondary accession number(s): Q2TQ40
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: November 30, 2010
Last modified: September 12, 2018
This is version 177 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again