Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 17

Gene

TNFRSF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5669034 TNFs bind their physiological receptors

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q02223

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 17
Alternative name(s):
B-cell maturation protein
CD_antigen: CD269
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNFRSF17
Synonyms:BCM, BCMA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000048462.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11913 TNFRSF17

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
109545 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q02223

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 54ExtracellularSequence analysisAdd BLAST54
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei55 – 77Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST23
Topological domaini78 – 184CytoplasmicSequence analysisAdd BLAST107

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei3 – 4Breakpoint for translocation to form IL2/TNFRSF17 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
608

Open Targets

More...
OpenTargetsi
ENSG00000048462

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36606

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TNFRSF17

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104029

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000589351 – 184Tumor necrosis factor receptor superfamily member 17Add BLAST184

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi8 ↔ 212 Publications
Disulfide bondi24 ↔ 372 Publications
Disulfide bondi28 ↔ 412 Publications

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q02223

PeptideAtlas

More...
PeptideAtlasi
Q02223

PRoteomics IDEntifications database

More...
PRIDEi
Q02223

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58062

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q02223

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q02223

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in mature B-cells, but not in T-cells or monocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000048462 Expressed in 105 organ(s), highest expression level in spleen

CleanEx database of gene expression profiles

More...
CleanExi
HS_TNFRSF17

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q02223 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q02223 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6.2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107080, 19 interactors

Protein interaction database and analysis system

More...
IntActi
Q02223, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000053243

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q02223

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q02223

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q02223

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati7 – 41TNFR-CysAdd BLAST35

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IW7R Eukaryota
ENOG4111D91 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154485

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000129926

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG062796

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q02223

KEGG Orthology (KO)

More...
KOi
K05153

Identification of Orthologs from Complete Genome Data

More...
OMAi
ACKPCHL

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0S5G

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q02223

TreeFam database of animal gene trees

More...
TreeFami
TF337842

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13414 TNFRSF17, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015337 BCMA_Tall-1-bd
IPR022320 TNFR_17

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09257 BCMA-Tall_bind, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF011859 BCMA_Tall-1_bd, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01967 TNFACTORR17

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q02223-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK
60 70 80 90 100
GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA
110 120 130 140 150
NIDLEKSRTG DEIILPRGLE YTVEECTCED CIKSKPKVDS DHCFPLPAME
160 170 180
EGATILVTTK TNDYCKSLPA ALSATEIEKS ISAR
Length:184
Mass (Da):20,165
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB6D87B3685F66022
GO
Isoform 2 (identifier: Q02223-2) [UniParc]FASTAAdd to basket
Also known as: TV4

The sequence of this isoform differs from the canonical sequence as follows:
     44-93: SVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTG → R

Note: Observed only in some CD19+ cell.
Show »
Length:135
Mass (Da):14,843
Checksum:iFC3D1DDBB1195989
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BMB5H3BMB5_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF17
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01875554A → V1 PublicationCorresponds to variant dbSNP:rs11570146Ensembl.1
Natural variantiVAR_01875665I → V1 PublicationCorresponds to variant dbSNP:rs11570147Ensembl.1
Natural variantiVAR_01875775F → V1 PublicationCorresponds to variant dbSNP:rs11570148Ensembl.1
Natural variantiVAR_01875881N → S5 PublicationsCorresponds to variant dbSNP:rs373496Ensembl.1
Natural variantiVAR_012234153A → T1 PublicationCorresponds to variant dbSNP:rs150352299Ensembl.1
Natural variantiVAR_018759165C → S1 PublicationCorresponds to variant dbSNP:rs11570159Ensembl.1
Natural variantiVAR_061855176E → D. Corresponds to variant dbSNP:rs34546237Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04767844 – 93SVTNS…FKNTG → R in isoform 2. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z14954 mRNA Translation: CAA78679.1
Z29574 Genomic DNA Translation: CAA82690.1
Z29575 mRNA Translation: CAA82691.1
AB052772 Genomic DNA Translation: BAB60895.1
EF152355 mRNA Translation: ABN42510.1
AY684975 mRNA Translation: AAV92616.1
AY509112 Genomic DNA Translation: AAR84240.1
U95742 Genomic DNA Translation: AAB67251.1
AC007216 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10552.1 [Q02223-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S43486

NCBI Reference Sequences

More...
RefSeqi
NP_001183.2, NM_001192.2 [Q02223-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.2556

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000053243; ENSP00000053243; ENSG00000048462 [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462 [Q02223-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
608

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:608

UCSC genome browser

More...
UCSCi
uc002dbv.3 human [Q02223-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z14954 mRNA Translation: CAA78679.1
Z29574 Genomic DNA Translation: CAA82690.1
Z29575 mRNA Translation: CAA82691.1
AB052772 Genomic DNA Translation: BAB60895.1
EF152355 mRNA Translation: ABN42510.1
AY684975 mRNA Translation: AAV92616.1
AY509112 Genomic DNA Translation: AAR84240.1
U95742 Genomic DNA Translation: AAB67251.1
AC007216 Genomic DNA No translation available.
CCDSiCCDS10552.1 [Q02223-1]
PIRiS43486
RefSeqiNP_001183.2, NM_001192.2 [Q02223-1]
UniGeneiHs.2556

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OQDX-ray2.60K/L/M/N/O/P/Q/R8-46[»]
1XU2X-ray2.35R/S/T5-51[»]
2KN1NMR-A2-50[»]
4ZFOX-ray1.90F/K1-54[»]
ProteinModelPortaliQ02223
SMRiQ02223
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107080, 19 interactors
IntActiQ02223, 5 interactors
STRINGi9606.ENSP00000053243

PTM databases

iPTMnetiQ02223
PhosphoSitePlusiQ02223

Polymorphism and mutation databases

BioMutaiTNFRSF17
DMDMi313104029

Proteomic databases

PaxDbiQ02223
PeptideAtlasiQ02223
PRIDEiQ02223
ProteomicsDBi58062

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
608
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462 [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462 [Q02223-2]
GeneIDi608
KEGGihsa:608
UCSCiuc002dbv.3 human [Q02223-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
608
DisGeNETi608
EuPathDBiHostDB:ENSG00000048462.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TNFRSF17
HGNCiHGNC:11913 TNFRSF17
MIMi109545 gene
neXtProtiNX_Q02223
OpenTargetsiENSG00000048462
PharmGKBiPA36606

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IW7R Eukaryota
ENOG4111D91 LUCA
GeneTreeiENSGT00940000154485
HOGENOMiHOG000129926
HOVERGENiHBG062796
InParanoidiQ02223
KOiK05153
OMAiACKPCHL
OrthoDBiEOG091G0S5G
PhylomeDBiQ02223
TreeFamiTF337842

Enzyme and pathway databases

ReactomeiR-HSA-5669034 TNFs bind their physiological receptors
SIGNORiQ02223

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TNFRSF17 human
EvolutionaryTraceiQ02223

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TNFRSF17

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
608

Protein Ontology

More...
PROi
PR:Q02223

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000048462 Expressed in 105 organ(s), highest expression level in spleen
CleanExiHS_TNFRSF17
ExpressionAtlasiQ02223 baseline and differential
GenevisibleiQ02223 HS

Family and domain databases

CDDicd13414 TNFRSF17, 1 hit
InterProiView protein in InterPro
IPR015337 BCMA_Tall-1-bd
IPR022320 TNFR_17
PfamiView protein in Pfam
PF09257 BCMA-Tall_bind, 1 hit
PIRSFiPIRSF011859 BCMA_Tall-1_bd, 1 hit
PRINTSiPR01967 TNFACTORR17

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNR17_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q02223
Secondary accession number(s): Q2TQ40
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: November 30, 2010
Last modified: December 5, 2018
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again