Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-binding protein SATB1

Gene

SATB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Crucial silencing factor contributing to the initiation of X inactivation mediated by Xist RNA that occurs during embryogenesis and in lymphoma (By similarity). Binds to DNA at special AT-rich sequences, the consensus SATB1-binding sequence (CSBS), at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcriptional repressor controlling nuclear and viral gene expression in a phosphorylated and acetylated status-dependent manner, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. Acts as a docking site for several chromatin remodeling enzymes (e.g. PML at the MHC-I locus) and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. Modulates genes that are essential in the maturation of the immune T-cell CD8SP from thymocytes. Required for the switching of fetal globin species, and beta- and gamma-globin genes regulation during erythroid differentiation. Plays a role in chromatin organization and nuclear architecture during apoptosis. Interacts with the unique region (UR) of cytomegalovirus (CMV). Alu-like motifs and SATB1-binding sites provide a unique chromatin context which seems preferentially targeted by the HIV-1 integration machinery. Moreover, HIV-1 Tat may overcome SATB1-mediated repression of IL2 and IL2RA (interleukin) in T-cells by binding to the same domain than HDAC1. Delineates specific epigenetic modifications at target gene loci, directly up-regulating metastasis-associated genes while down-regulating tumor-suppressor genes. Reprograms chromatin organization and the transcription profiles of breast tumors to promote growth and metastasis.By similarity18 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei390Matrix attachment region (MAR) DNA1
Binding sitei425Matrix attachment region (MAR) DNA1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi361 – 448CUT 1PROSITE-ProRule annotationAdd BLAST88
DNA bindingi484 – 571CUT 2PROSITE-ProRule annotationAdd BLAST88
DNA bindingi645 – 704HomeoboxPROSITE-ProRule annotationAdd BLAST60

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding, Repressor
Biological processHost-virus interaction, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q01826

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA-binding protein SATB1
Alternative name(s):
Special AT-rich sequence-binding protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SATB1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182568.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10541 SATB1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602075 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q01826

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi29K → A: Loss of nuclear localization, cytoplasmic. 1 Publication1
Mutagenesisi32R → A: Loss of nuclear localization, cytoplasmic. 1 Publication1
Mutagenesisi34E → A: Normal nuclear localization. 1 Publication1
Mutagenesisi36N → A: Normal nuclear localization. 1 Publication1
Mutagenesisi136K → A, Q or R: No acetylation. 2 Publications1
Mutagenesisi185S → A: No phosphorylation. 1 Publication1
Mutagenesisi254D → A: CASP6-resistant. 1 Publication1
Mutagenesisi373S → A: Slightly reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi380R → N: Reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi384K → N: Impaired MAR-DNA-binding. 1 Publication1
Mutagenesisi395R → N: Reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi402Q → A: Impaired MAR-DNA-binding. 1 Publication1
Mutagenesisi403G → A: Impaired MAR-DNA-binding. 1 Publication1
Mutagenesisi406S → A: Impaired MAR-DNA-binding. 1 Publication1
Mutagenesisi410R → N: Impaired MAR-DNA-binding. 1 Publication1
Mutagenesisi411K → R: Normal sumoylation. 1 Publication1
Mutagenesisi416K → N: Impaired MAR-DNA-binding. 1 Publication1
Mutagenesisi427R → N: Reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi442R → N: Reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi451S → A: Slightly reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi475K → N: Reduced MAR-DNA-binding. 1 Publication1
Mutagenesisi486K → R: Normal sumoylation. 1 Publication1
Mutagenesisi646R → A: Reduced interaction with matrix attachment region (MAR) DNA; when associated with A-648. 1 Publication1
Mutagenesisi648R → A: Reduced interaction with matrix attachment region (MAR) DNA; when associated with A-646. 1 Publication1
Mutagenesisi693 – 695FQN → AAA: Reduced interaction with matrix attachment region (MAR) DNA. 1 Publication3
Mutagenesisi720K → R: Normal sumoylation. 1 Publication1
Mutagenesisi744K → R: Loss of sumoylation. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6304

Open Targets

More...
OpenTargetsi
ENSG00000182568

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34951

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SATB1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
417747

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002023981 – 763DNA-binding protein SATB1Add BLAST763

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki51Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei136N6-acetyllysine1 Publication1
Modified residuei185Phosphoserine1 Publication1
Modified residuei637PhosphoserineBy similarity1
Cross-linki744Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated. Sumoylation promotes cleavage by caspases.2 Publications
Phosphorylated by PKC. Acetylated by PCAF. Phosphorylated form interacts with HDAC1, but unphosphorylated form interacts with PCAF. DNA binding properties are activated by phosphorylation and inactivated by acetylation. In opposition, gene expression is down-regulated by phosphorylation but up-regulated by acetylation.1 Publication
Cleaved at Asp-254 by caspase-3 and caspase-6 during T-cell apoptosis in thymus and during B-cell stimulation. The cleaved forms cannot dimerize and lose transcription regulation function because of impaired DNA and chromatin association.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei254 – 255Cleavage; by caspases2

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q01826

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q01826

PeptideAtlas

More...
PeptideAtlasi
Q01826

PRoteomics IDEntifications database

More...
PRIDEi
Q01826

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58001
58002 [Q01826-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q01826

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q01826

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q01826

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in thymus.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182568 Expressed in 243 organ(s), highest expression level in thymus

CleanEx database of gene expression profiles

More...
CleanExi
HS_SATB1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q01826 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q01826 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB056144
HPA051769

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CUX1 (via DNA-binding domains); the interaction inhibits the attachment of both proteins to DNA (By similarity). Homodimer. Part of the nuclear protein complex gamma-globin promoter and enhancer binding factor (gamma-PE) composed at least of SATB1 and HOXB2. Interaction with CtBP1 when not acetylated stabalizes attachment to DNA and promotes transcription repression. Interacts with PCAF. Interacts with sumoylated PML and HDAC1 via the PDZ-like dimerization domain. Interacts also with DYNLT3 and POLR2J2. Binds to EP300.By similarity13 Publications
(Microbial infection) Interacts (via the PDZ-like dimerization domain) with HIV-1 Tat.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112211, 58 interactors

Database of interacting proteins

More...
DIPi
DIP-48757N

Protein interaction database and analysis system

More...
IntActi
Q01826, 33 interactors

Molecular INTeraction database

More...
MINTi
Q01826

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1763
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q01826

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q01826

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q01826

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni90 – 204PDZ-like dimerization domainAdd BLAST115
Regioni224 – 278Nuclear matrix targeting sequence (NMTS)Add BLAST55
Regioni400 – 410Matrix attachment region (MAR) DNA-bindingAdd BLAST11

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi20 – 40Nuclear localization signal1 PublicationAdd BLAST21
Motifi139 – 143Protein interaction5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi591 – 607Poly-GlnAdd BLAST17
Compositional biasi609 – 614Poly-Pro6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CUT homeobox family.Curated

Keywords - Domaini

Homeobox, Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008096

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000004805

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054240

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q01826

Identification of Orthologs from Complete Genome Data

More...
OMAi
TGTKMQG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G02HV

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q01826

TreeFam database of animal gene trees

More...
TreeFami
TF332714

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00086 homeodomain, 1 hit
cd11585 SATB1_N, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.260.70, 1 hit
3.10.20.710, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003350 CUT_dom
IPR032355 CUTL
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR010982 Lambda_DNA-bd_dom_sf
IPR039673 SATB1/SATB2
IPR038216 SATB_CUTL_sf
IPR038224 SATB_ULD_sf
IPR032392 ULD

The PANTHER Classification System

More...
PANTHERi
PTHR15116 PTHR15116, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02376 CUT, 2 hits
PF16557 CUTL, 1 hit
PF00046 Homeodomain, 1 hit
PF16534 ULD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01109 CUT, 2 hits
SM00389 HOX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit
SSF47413 SSF47413, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51042 CUT, 2 hits
PS50071 HOMEOBOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q01826-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDHLNEATQG KEHSEMSNNV SDPKGPPAKI ARLEQNGSPL GRGRLGSTGA
60 70 80 90 100
KMQGVPLKHS GHLMKTNLRK GTMLPVFCVV EHYENAIEYD CKEEHAEFVL
110 120 130 140 150
VRKDMLFNQL IEMALLSLGY SHSSAAQAKG LIQVGKWNPV PLSYVTDAPD
160 170 180 190 200
ATVADMLQDV YHVVTLKIQL HSCPKLEDLP PEQWSHTTVR NALKDLLKDM
210 220 230 240 250
NQSSLAKECP LSQSMISSIV NSTYYANVSA AKCQEFGRWY KHFKKTKDMM
260 270 280 290 300
VEMDSLSELS QQGANHVNFG QQPVPGNTAE QPPSPAQLSH GSQPSVRTPL
310 320 330 340 350
PNLHPGLVST PISPQLVNQQ LVMAQLLNQQ YAVNRLLAQQ SLNQQYLNHP
360 370 380 390 400
PPVSRSMNKP LEQQVSTNTE VSSEIYQWVR DELKRAGISQ AVFARVAFNR
410 420 430 440 450
TQGLLSEILR KEEDPKTASQ SLLVNLRAMQ NFLQLPEAER DRIYQDERER
460 470 480 490 500
SLNAASAMGP APLISTPPSR PPQVKTATIA TERNGKPENN TMNINASIYD
510 520 530 540 550
EIQQEMKRAK VSQALFAKVA ATKSQGWLCE LLRWKEDPSP ENRTLWENLS
560 570 580 590 600
MIRRFLSLPQ PERDAIYEQE SNAVHHHGDR PPHIIHVPAE QIQQQQQQQQ
610 620 630 640 650
QQQQQQQAPP PPQPQQQPQT GPRLPPRQPT VASPAESDEE NRQKTRPRTK
660 670 680 690 700
ISVEALGILQ SFIQDVGLYP DEEAIQTLSA QLDLPKYTII KFFQNQRYYL
710 720 730 740 750
KHHGKLKDNS GLEVDVAEYK EEELLKDLEE SVQDKNTNTL FSVKLEEELS
760
VEGNTDINTD LKD
Length:763
Mass (Da):85,957
Last modified:October 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD4FE09B09FB7683B
GO
Isoform 2 (identifier: Q01826-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     592-592: I → IQSPSPTTLGKGESRGVFLPGLPTPAPWLGAAP

Show »
Length:795
Mass (Da):89,127
Checksum:i4883C06CCD96D9FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WW22A0A087WW22_HUMAN
DNA-binding protein SATB1
SATB1
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JP21C9JP21_HUMAN
DNA-binding protein SATB1
SATB1
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZC5C9IZC5_HUMAN
DNA-binding protein SATB1
SATB1
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGL9C9JGL9_HUMAN
DNA-binding protein SATB1
SATB1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLL5C9JLL5_HUMAN
DNA-binding protein SATB1
SATB1
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7F3C9J7F3_HUMAN
DNA-binding protein SATB1
SATB1
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WW75A0A087WW75_HUMAN
DNA-binding protein SATB1
SATB1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YN86H0YN86_HUMAN
DNA-binding protein SATB1
SATB1
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3I0C9J3I0_HUMAN
DNA-binding protein SATB1
SATB1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMP0A0A1D5RMP0_HUMAN
DNA-binding protein SATB1
SATB1
8Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD92998 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038296592I → IQSPSPTTLGKGESRGVFLP GLPTPAPWLGAAP in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M97287 mRNA Translation: AAA60304.1
AK127242 mRNA Translation: BAG54463.1
AB209761 mRNA Translation: BAD92998.1 Different initiation.
AC139618 Genomic DNA No translation available.
AC144521 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64291.1
BC001744 mRNA Translation: AAH01744.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2631.1 [Q01826-1]
CCDS56242.1 [Q01826-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A43314

NCBI Reference Sequences

More...
RefSeqi
NP_001124482.1, NM_001131010.3 [Q01826-1]
NP_001182399.1, NM_001195470.2 [Q01826-2]
NP_001309800.1, NM_001322871.1 [Q01826-2]
NP_001309801.1, NM_001322872.1 [Q01826-1]
NP_001309802.1, NM_001322873.1 [Q01826-1]
NP_001309803.1, NM_001322874.1 [Q01826-1]
NP_001309804.1, NM_001322875.1 [Q01826-1]
NP_002962.1, NM_002971.5 [Q01826-1]
XP_011532290.1, XM_011533988.2 [Q01826-2]
XP_011532291.1, XM_011533989.2 [Q01826-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.517717
Hs.593276

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338745; ENSP00000341024; ENSG00000182568 [Q01826-1]
ENST00000417717; ENSP00000399518; ENSG00000182568 [Q01826-2]
ENST00000454909; ENSP00000399708; ENSG00000182568 [Q01826-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6304

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6304

UCSC genome browser

More...
UCSCi
uc003cbh.4 human [Q01826-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M97287 mRNA Translation: AAA60304.1
AK127242 mRNA Translation: BAG54463.1
AB209761 mRNA Translation: BAD92998.1 Different initiation.
AC139618 Genomic DNA No translation available.
AC144521 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64291.1
BC001744 mRNA Translation: AAH01744.1
CCDSiCCDS2631.1 [Q01826-1]
CCDS56242.1 [Q01826-2]
PIRiA43314
RefSeqiNP_001124482.1, NM_001131010.3 [Q01826-1]
NP_001182399.1, NM_001195470.2 [Q01826-2]
NP_001309800.1, NM_001322871.1 [Q01826-2]
NP_001309801.1, NM_001322872.1 [Q01826-1]
NP_001309802.1, NM_001322873.1 [Q01826-1]
NP_001309803.1, NM_001322874.1 [Q01826-1]
NP_001309804.1, NM_001322875.1 [Q01826-1]
NP_002962.1, NM_002971.5 [Q01826-1]
XP_011532290.1, XM_011533988.2 [Q01826-2]
XP_011532291.1, XM_011533989.2 [Q01826-2]
UniGeneiHs.517717
Hs.593276

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1YSENMR-A353-490[»]
2L1PNMR-A179-250[»]
2MW8NMR-A641-707[»]
2O49X-ray2.00A368-452[»]
2O4AX-ray1.75A368-452[»]
3NZLX-ray1.20A179-250[»]
3TUOX-ray1.70A/B/C/D71-171[»]
ProteinModelPortaliQ01826
SMRiQ01826
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112211, 58 interactors
DIPiDIP-48757N
IntActiQ01826, 33 interactors
MINTiQ01826

PTM databases

iPTMnetiQ01826
PhosphoSitePlusiQ01826

Polymorphism and mutation databases

BioMutaiSATB1
DMDMi417747

Proteomic databases

EPDiQ01826
MaxQBiQ01826
PeptideAtlasiQ01826
PRIDEiQ01826
ProteomicsDBi58001
58002 [Q01826-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6304
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338745; ENSP00000341024; ENSG00000182568 [Q01826-1]
ENST00000417717; ENSP00000399518; ENSG00000182568 [Q01826-2]
ENST00000454909; ENSP00000399708; ENSG00000182568 [Q01826-1]
GeneIDi6304
KEGGihsa:6304
UCSCiuc003cbh.4 human [Q01826-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6304
DisGeNETi6304
EuPathDBiHostDB:ENSG00000182568.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SATB1
HGNCiHGNC:10541 SATB1
HPAiCAB056144
HPA051769
MIMi602075 gene
neXtProtiNX_Q01826
OpenTargetsiENSG00000182568
PharmGKBiPA34951

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000008096
HOGENOMiHOG000004805
HOVERGENiHBG054240
InParanoidiQ01826
OMAiTGTKMQG
OrthoDBiEOG091G02HV
PhylomeDBiQ01826
TreeFamiTF332714

Enzyme and pathway databases

ReactomeiR-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
SIGNORiQ01826

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SATB1 human
EvolutionaryTraceiQ01826

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SATB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6304
PMAP-CutDBiQ01826

Protein Ontology

More...
PROi
PR:Q01826

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182568 Expressed in 243 organ(s), highest expression level in thymus
CleanExiHS_SATB1
ExpressionAtlasiQ01826 baseline and differential
GenevisibleiQ01826 HS

Family and domain databases

CDDicd00086 homeodomain, 1 hit
cd11585 SATB1_N, 1 hit
Gene3Di1.10.260.70, 1 hit
3.10.20.710, 1 hit
InterProiView protein in InterPro
IPR003350 CUT_dom
IPR032355 CUTL
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR010982 Lambda_DNA-bd_dom_sf
IPR039673 SATB1/SATB2
IPR038216 SATB_CUTL_sf
IPR038224 SATB_ULD_sf
IPR032392 ULD
PANTHERiPTHR15116 PTHR15116, 1 hit
PfamiView protein in Pfam
PF02376 CUT, 2 hits
PF16557 CUTL, 1 hit
PF00046 Homeodomain, 1 hit
PF16534 ULD, 1 hit
SMARTiView protein in SMART
SM01109 CUT, 2 hits
SM00389 HOX, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
SSF47413 SSF47413, 2 hits
PROSITEiView protein in PROSITE
PS51042 CUT, 2 hits
PS50071 HOMEOBOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSATB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q01826
Secondary accession number(s): B3KXF1, C9JTR6, Q59EQ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: December 5, 2018
This is version 185 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again