Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 170 (13 Nov 2019)
Sequence version 3 (01 Feb 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sodium/calcium exchanger 1

Gene

Slc8a1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates the exchange of one Ca2+ ion against three to four Na+ ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca2+ levels and Ca2+-dependent cellular processes (PubMed:8422940, PubMed:8454039, PubMed:10894800, PubMed:12502557). Contributes to Ca2+ transport during excitation-contraction coupling in muscle. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca2+ levels due to release of Ca2+ stores from the endoplasmic reticulum. SLC8A1 mediates the export of Ca2+ from the cell during the next phase, so that cytoplasmic Ca2+ levels rapidly return to baseline. Required for normal embryonic heart development and the onset of heart contractions (By similarity).By similarity5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by micromolar levels of Ca2+ (PubMed:12502557). Isoform 4 and isoform 6 are only active at low calcium concentrations but isoform 5 is active at all calcium levels tested. Isoform 5 and isoform 6, but not isoform 4, are activated by PKC (PubMed:15040000).2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi417Calcium 1By similarity1
Metal bindingi417Calcium 2By similarity1
Metal bindingi417Calcium 3By similarity1
Metal bindingi453Calcium 1By similarity1
Metal bindingi453Calcium 4By similarity1
Metal bindingi478Calcium 2By similarity1
Metal bindingi479Calcium 1By similarity1
Metal bindingi479Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi479Calcium 3By similarity1
Metal bindingi479Calcium 4By similarity1
Metal bindingi481Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi483Calcium 1By similarity1
Metal bindingi483Calcium 3By similarity1
Metal bindingi483Calcium 4By similarity1
Metal bindingi486Calcium 4By similarity1
Metal bindingi530Calcium 3By similarity1
Metal bindingi531Calcium 2By similarity1
Metal bindingi532Calcium 2By similarity1
Metal bindingi532Calcium 3By similarity1
Metal bindingi548Calcium 5By similarity1
Metal bindingi584Calcium 6By similarity1
Metal bindingi610Calcium 5By similarity1
Metal bindingi610Calcium 6By similarity1
Metal bindingi611Calcium 6By similarity1
Metal bindingi612Calcium 5; via carbonyl oxygenBy similarity1
Metal bindingi612Calcium 6By similarity1
Metal bindingi716Calcium 5By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding
Biological processAntiport, Calcium transport, Ion transport, Sodium transport, Transport
LigandCalcium, Metal-binding, Sodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-418359 Reduction of cytosolic Ca++ levels
R-RNO-425561 Sodium/Calcium exchangers
R-RNO-5578775 Ion homeostasis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/calcium exchanger 1
Alternative name(s):
Na(+)/Ca(2+)-exchange protein 1
Solute carrier family 8 member 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc8a1
Synonyms:Ncx1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Rat genome database

More...
RGDi
3717 Slc8a1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini33 – 71ExtracellularSequence analysisAdd BLAST39
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 133CytoplasmicSequence analysisAdd BLAST41
Transmembranei134 – 154HelicalSequence analysisAdd BLAST21
Topological domaini155 – 167ExtracellularSequence analysisAdd BLAST13
Transmembranei168 – 188HelicalSequence analysisAdd BLAST21
Topological domaini189 – 201CytoplasmicSequence analysisAdd BLAST13
Transmembranei202 – 222HelicalSequence analysisAdd BLAST21
Topological domaini223 – 228ExtracellularSequence analysis6
Transmembranei229 – 249HelicalSequence analysisAdd BLAST21
Topological domaini250 – 798CytoplasmicSequence analysisAdd BLAST549
Transmembranei799 – 819HelicalSequence analysisAdd BLAST21
Topological domaini820 – 822ExtracellularSequence analysis3
Transmembranei823 – 843HelicalSequence analysisAdd BLAST21
Topological domaini844 – 872CytoplasmicSequence analysisAdd BLAST29
Transmembranei873 – 893HelicalSequence analysisAdd BLAST21
Topological domaini894 – 904ExtracellularSequence analysisAdd BLAST11
Transmembranei905 – 925HelicalSequence analysisAdd BLAST21
Topological domaini926 – 942CytoplasmicSequence analysisAdd BLAST17
Transmembranei943 – 963HelicalSequence analysisAdd BLAST21
Topological domaini964 – 971ExtracellularSequence analysis8

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 32Sequence analysisAdd BLAST32
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001938133 – 971Sodium/calcium exchanger 1Add BLAST939

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi41N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi157N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei282PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q01728

PRoteomics IDEntifications database

More...
PRIDEi
Q01728

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q01728

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q01728

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q01728

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in heart, brain cortex and hippocampus (at protein level) (PubMed:16914199). Cardiac sarcolemma or brain, and spleen. Expressed in all regions of the kidney, highest levels of expression in the distal convoluted tubule. Expressed throughout the CNS, in decreasing order of abundance in hippocampus, cortex, cerebellum, hypothalamus, midbrain and striatum. Expressed in numerous regions of the brain including multiple cortical layers, hippocampus, septal nuclei, thalamic nuclei, cerebellum, hypothalamus, olfactory bulb and brainstem. Also expressed in various regions of the spinal cord, ventricles and atria of the heart, lung, adrenals and kidney. Isoform 4 seems to be a predominant isoform in aorta, stomach, liver, and kidney.5 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000008479 Expressed in 9 organ(s), highest expression level in heart

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q01728 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q01728 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
248332, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q01728

Protein interaction database and analysis system

More...
IntActi
Q01728, 29 interactors

Molecular INTeraction database

More...
MINTi
Q01728

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000040751

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q01728

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati138 – 178Alpha-1Add BLAST41
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini393 – 493Calx-beta 1Add BLAST101
Domaini524 – 624Calx-beta 2Add BLAST101
Repeati840 – 876Alpha-2Add BLAST37

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni251 – 270Putative calmodulin-binding regionBy similarityAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi236 – 239Poly-Phe4
Compositional biasi690 – 693Poly-Glu4
Compositional biasi757 – 761Poly-Asp5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytoplasmic Calx-beta domains bind the regulatory Ca2+. The first Calx-beta domain can bind up to four Ca2+ ions. The second domain can bind another two Ca2+ ions that are essential for calcium-regulated ion exchange.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1306 Eukaryota
ENOG410XPJP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155129

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000266971

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q01728

KEGG Orthology (KO)

More...
KOi
K05849

Identification of Orthologs from Complete Genome Data

More...
OMAi
HFICLFW

Database of Orthologous Groups

More...
OrthoDBi
490546at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q01728

TreeFam database of animal gene trees

More...
TreeFami
TF314308

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.2030, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038081 CalX-like_sf
IPR003644 Calx_beta
IPR001623 DnaJ_domain
IPR004836 Na_Ca_Ex
IPR032452 Na_Ca_Ex_C-exten
IPR002987 NaCa_exhngr1
IPR004837 NaCa_Exmemb

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03160 Calx-beta, 2 hits
PF01699 Na_Ca_ex, 2 hits
PF16494 Na_Ca_ex_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01259 NACAEXCHNGR
PR01260 NACAEXCHNGR1

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00237 Calx_beta, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF141072 SSF141072, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00845 caca, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q01728-1) [UniParc]FASTAAdd to basket
Also known as: Heart, NaCa1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRLSLPPNV SMGFRLVTLV ALLFTHVDHI TADTEAETGG NETTECTGSY
60 70 80 90 100
YCKKGVILPI WEPQDPSFGD KIARATVYFV AMVYMFLGVS IIADRFMSSI
110 120 130 140 150
EVITSQEKEI TIKKPNGETT KTTVRIWNET VSNLTLMALG SSAPEILLSV
160 170 180 190 200
IEVCGHNFTA GDLGPSTIVG SAAFNMFIII ALCVYVVPDG ETRKIKHLRV
210 220 230 240 250
FFVTAAWSIF AYTWLYIILS VSSPGVVEVW EGLLTFFFFP ICVVFAWVAD
260 270 280 290 300
RRLLFYKYVY KRYRAGKQRG MIIEHEGDRP ASKTEIEMDG KVVNSHVDNF
310 320 330 340 350
LDGALVLEVD ERDQDDEEAR REMARILKEL KQKHPDKEIE QLIELANYQV
360 370 380 390 400
LSQQQKSRAF YRIQATRLMT GAGNILKRHA ADQARKAVSM HEVNMDVVEN
410 420 430 440 450
DPVSKVFFEQ GTYQCLENCG TVALTIIRRG GDLTNTVFVD FRTEDGTANA
460 470 480 490 500
GSDYEFTEGT VIFKPGETQK EIRVGIIDDD IFEEDENFLV HLSNVRVSSE
510 520 530 540 550
VSEDGILDSN HVSAIACLGS PNTATITIFD DDHAGIFTFE EPVTHVSESI
560 570 580 590 600
GIMEVKVLRT SGARGNVIIP YKTIEGTARG GGEDFEDTCG ELEFQNDEIV
610 620 630 640 650
KTISVKVIDD EEYEKNKTFF IEIGEPRLVE MSEKKALLLN ELGGFTLTEG
660 670 680 690 700
KKMYGQPVFR KVHARDHPIP STVISISEEY DDKQPLTSKE EEERRIAEMG
710 720 730 740 750
RPILGEHTKL EVIIEESYEF KSTVDKLIKK TNLALVVGTN SWREQFIEAI
760 770 780 790 800
TVSAGEDDDD DECGEEKLPS CFDYVMHFLT VFWKVLFAFV PPTEYWNGWA
810 820 830 840 850
CFIVSILMIG LLTAFIGDLA SHFGCTIGLK DSVTAVVFVA LGTSVPDTFA
860 870 880 890 900
SKVAATQDQY ADASIGNVTG SNAVNVFLGI GVAWSIAAIY HAANGEQFKV
910 920 930 940 950
SPGTLAFSVT LFTIFAFINV GVLLYRRRPE IGGELGGPRT AKLLTSSLFV
960 970
LLWLLYIFFS SLEAYCHIKG F
Length:971
Mass (Da):108,185
Last modified:February 1, 1996 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEC456CFE3AFC6A69
GO
Isoform 2 (identifier: Q01728-2) [UniParc]FASTAAdd to basket
Also known as: Brain-1, NaCa5

The sequence of this isoform differs from the canonical sequence as follows:
     636-642: Missing.
     649-654: Missing.

Show »
Length:958
Mass (Da):106,681
Checksum:i1F2B3B90E7F5E3D8
GO
Isoform 3 (identifier: Q01728-3) [UniParc]FASTAAdd to basket
Also known as: Brain-2, NaCa4

The sequence of this isoform differs from the canonical sequence as follows:
     636-642: Missing.
     649-677: Missing.

Show »
Length:935
Mass (Da):104,157
Checksum:i40F966A2E0984167
GO
Isoform 4 (identifier: Q01728-4) [UniParc]FASTAAdd to basket
Also known as: Kidney-1, NaCa7, SNCX1

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     636-642: Missing.
     649-654: Missing.

Show »
Length:957
Mass (Da):106,751
Checksum:iD4603BC36F1787E8
GO
Isoform 5 (identifier: Q01728-5) [UniParc]FASTAAdd to basket
Also known as: Kidney-2, NaCa3, RNCX1

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     636-642: Missing.
     649-677: Missing.

Show »
Length:934
Mass (Da):104,227
Checksum:i24E41720DFC99776
GO
Isoform 6 (identifier: Q01728-6) [UniParc]FASTAAdd to basket
Also known as: SDNCX1.10

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     636-642: Missing.
     649-649: Missing.

Show »
Length:962
Mass (Da):107,359
Checksum:iD0EC796D48D5D883
GO
Isoform 7 (identifier: Q01728-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     649-649: Missing.

Show »
Length:969
Mass (Da):108,126
Checksum:i7C9C7E57A323AD8F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R3V7M0R3V7_RAT
Sodium/calcium exchanger 1
Slc8a1
965Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti148L → P in AAD23388 (PubMed:10894800).Curated1
Sequence conflicti148L → P in AAD23389 (PubMed:10894800).Curated1
Sequence conflicti148L → P in AAK52307 (PubMed:15040000).Curated1
Sequence conflicti218I → F in AAD23387 (PubMed:10894800).Curated1
Sequence conflicti250D → A in CAA48273 (PubMed:8422940).Curated1
Sequence conflicti402P → A in CAA48273 (PubMed:8422940).Curated1
Sequence conflicti438F → S in AAD23386 (PubMed:10894800).Curated1
Sequence conflicti438F → S in AAD23387 (PubMed:10894800).Curated1
Sequence conflicti500E → G in AAD23388 (PubMed:10894800).Curated1
Sequence conflicti500E → G in AAK52307 (PubMed:15040000).Curated1
Sequence conflicti789F → N (PubMed:1415740).Curated1
Sequence conflicti861A → R (PubMed:1415740).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003401602 – 635TISVK…MSEKK → IITIRIFDREEYEKECSFSL VLEEPKWIRRGMK in isoform 4, isoform 5, isoform 6 and isoform 7. 4 PublicationsAdd BLAST34
Alternative sequenceiVSP_003402636 – 642Missing in isoform 2, isoform 3, isoform 4, isoform 5 and isoform 6. 5 Publications7
Alternative sequenceiVSP_003404649 – 677Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_003403649 – 654Missing in isoform 2 and isoform 4. 4 Publications6
Alternative sequenceiVSP_029836649Missing in isoform 6 and isoform 7. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X68191 mRNA Translation: CAA48273.1
X68812 mRNA Translation: CAA48707.1
X68813 mRNA Translation: CAA48708.1
U04933 mRNA Translation: AAB39952.1
U04934 mRNA Translation: AAA19124.1
U04936 mRNA Translation: AAA19125.1
AF109163 mRNA Translation: AAD23386.1
AF109164 mRNA Translation: AAD23387.1
AF109165 mRNA Translation: AAD23388.1
AF109166 mRNA Translation: AAD23389.1
AY033398 mRNA Translation: AAK52307.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A53789
I52640
S28833
S32435
S43730

NCBI Reference Sequences

More...
RefSeqi
NP_001257701.1, NM_001270772.1 [Q01728-3]
NP_001257702.1, NM_001270773.1 [Q01728-5]
NP_001257703.1, NM_001270774.1 [Q01728-2]
NP_001257704.1, NM_001270775.1 [Q01728-4]
NP_001257705.1, NM_001270776.1 [Q01728-7]
NP_001257706.1, NM_001270777.1 [Q01728-6]
XP_008762655.1, XM_008764433.2 [Q01728-7]
XP_008762659.1, XM_008764437.2 [Q01728-6]
XP_008762660.1, XM_008764438.2 [Q01728-2]
XP_008762661.1, XM_008764439.2 [Q01728-4]
XP_017449552.1, XM_017594063.1 [Q01728-3]
XP_017449553.1, XM_017594064.1 [Q01728-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000042230; ENSRNOP00000040751; ENSRNOG00000008479 [Q01728-1]
ENSRNOT00000042251; ENSRNOP00000040765; ENSRNOG00000008479 [Q01728-3]
ENSRNOT00000043870; ENSRNOP00000044094; ENSRNOG00000008479 [Q01728-7]
ENSRNOT00000046246; ENSRNOP00000043539; ENSRNOG00000008479 [Q01728-6]
ENSRNOT00000052367; ENSRNOP00000050918; ENSRNOG00000008479 [Q01728-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29715

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:29715

UCSC genome browser

More...
UCSCi
RGD:3717 rat [Q01728-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X68191 mRNA Translation: CAA48273.1
X68812 mRNA Translation: CAA48707.1
X68813 mRNA Translation: CAA48708.1
U04933 mRNA Translation: AAB39952.1
U04934 mRNA Translation: AAA19124.1
U04936 mRNA Translation: AAA19125.1
AF109163 mRNA Translation: AAD23386.1
AF109164 mRNA Translation: AAD23387.1
AF109165 mRNA Translation: AAD23388.1
AF109166 mRNA Translation: AAD23389.1
AY033398 mRNA Translation: AAK52307.1
PIRiA53789
I52640
S28833
S32435
S43730
RefSeqiNP_001257701.1, NM_001270772.1 [Q01728-3]
NP_001257702.1, NM_001270773.1 [Q01728-5]
NP_001257703.1, NM_001270774.1 [Q01728-2]
NP_001257704.1, NM_001270775.1 [Q01728-4]
NP_001257705.1, NM_001270776.1 [Q01728-7]
NP_001257706.1, NM_001270777.1 [Q01728-6]
XP_008762655.1, XM_008764433.2 [Q01728-7]
XP_008762659.1, XM_008764437.2 [Q01728-6]
XP_008762660.1, XM_008764438.2 [Q01728-2]
XP_008762661.1, XM_008764439.2 [Q01728-4]
XP_017449552.1, XM_017594063.1 [Q01728-3]
XP_017449553.1, XM_017594064.1 [Q01728-5]

3D structure databases

SMRiQ01728
ModBaseiSearch...

Protein-protein interaction databases

BioGridi248332, 10 interactors
CORUMiQ01728
IntActiQ01728, 29 interactors
MINTiQ01728
STRINGi10116.ENSRNOP00000040751

PTM databases

iPTMnetiQ01728
PhosphoSitePlusiQ01728
SwissPalmiQ01728

Proteomic databases

PaxDbiQ01728
PRIDEiQ01728

Genome annotation databases

EnsembliENSRNOT00000042230; ENSRNOP00000040751; ENSRNOG00000008479 [Q01728-1]
ENSRNOT00000042251; ENSRNOP00000040765; ENSRNOG00000008479 [Q01728-3]
ENSRNOT00000043870; ENSRNOP00000044094; ENSRNOG00000008479 [Q01728-7]
ENSRNOT00000046246; ENSRNOP00000043539; ENSRNOG00000008479 [Q01728-6]
ENSRNOT00000052367; ENSRNOP00000050918; ENSRNOG00000008479 [Q01728-2]
GeneIDi29715
KEGGirno:29715
UCSCiRGD:3717 rat [Q01728-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6546
RGDi3717 Slc8a1

Phylogenomic databases

eggNOGiKOG1306 Eukaryota
ENOG410XPJP LUCA
GeneTreeiENSGT00940000155129
HOGENOMiHOG000266971
InParanoidiQ01728
KOiK05849
OMAiHFICLFW
OrthoDBi490546at2759
PhylomeDBiQ01728
TreeFamiTF314308

Enzyme and pathway databases

ReactomeiR-RNO-418359 Reduction of cytosolic Ca++ levels
R-RNO-425561 Sodium/Calcium exchangers
R-RNO-5578775 Ion homeostasis

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q01728

Gene expression databases

BgeeiENSRNOG00000008479 Expressed in 9 organ(s), highest expression level in heart
ExpressionAtlasiQ01728 baseline and differential
GenevisibleiQ01728 RN

Family and domain databases

Gene3Di2.60.40.2030, 1 hit
InterProiView protein in InterPro
IPR038081 CalX-like_sf
IPR003644 Calx_beta
IPR001623 DnaJ_domain
IPR004836 Na_Ca_Ex
IPR032452 Na_Ca_Ex_C-exten
IPR002987 NaCa_exhngr1
IPR004837 NaCa_Exmemb
PfamiView protein in Pfam
PF03160 Calx-beta, 2 hits
PF01699 Na_Ca_ex, 2 hits
PF16494 Na_Ca_ex_C, 1 hit
PRINTSiPR01259 NACAEXCHNGR
PR01260 NACAEXCHNGR1
SMARTiView protein in SMART
SM00237 Calx_beta, 2 hits
SUPFAMiSSF141072 SSF141072, 2 hits
TIGRFAMsiTIGR00845 caca, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNAC1_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q01728
Secondary accession number(s): Q924Y2
, Q9QW49, Q9R238, Q9R239, Q9WU29, Q9WU30
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: February 1, 1996
Last modified: November 13, 2019
This is version 170 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again