UniProtKB - Q01664 (TFAP4_HUMAN)

BLAST

>sp|Q01664|TFAP4_HUMAN Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAP
PPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

Align
Format
Add to basket Added to basket
History
Entry version 178 (07 Nov 2018)
Sequence version 2 (01 Oct 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Transcription factor AP-4

Gene

TFAP4

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence 5'-CAGCTG-3'.

GO - Molecular functionⁱ

DNA binding
Source: UniProtKB
Inferred from direct assayⁱ
- 9931457
DNA-binding transcription factor activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
DNA-binding transcription factor activity, RNA polymerase II-specific Source: NTNU_SB
E-box binding
Source: UniProtKB
Inferred from direct assayⁱ
histone deacetylase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 16540471
- 16924111
protein homodimerization activity
Source: UniProtKB
Inferred from physical interactionⁱ
- 2123466
proximal promoter DNA-binding transcription activator activity, RNA polymerase II-specific Source: Ensembl
sequence-specific DNA binding
Source: UniProtKB
Inferred from direct assayⁱ
- 2123466
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
Source: UniProtKB
Inferred from direct assayⁱ
- 2833704
transcription regulatory region DNA binding
Source: UniProtKB
Inferred from direct assayⁱ
- 14645924
- 16540471

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular response to dexamethasone stimulus Source: Ensembl
DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
Source: UniProtKB
Inferred from direct assayⁱ
- 18818310
negative regulation by host of viral transcription
Source: UniProtKB
Inferred from direct assayⁱ
- 14645924
- 16540471
negative regulation of cell cycle arrest
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 18818310
negative regulation of cell proliferation
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 18818310
negative regulation of cyclin-dependent protein serine/threonine kinase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 18818310
negative regulation of DNA binding
Source: UniProtKB
Inferred from direct assayⁱ
- 16540471
- 7933101
negative regulation of transcription, DNA-templated
Source: UniProtKB
Inferred from direct assayⁱ
positive regulation by host of viral transcription
Source: UniProtKB
Inferred from direct assayⁱ
- 2833704
positive regulation of apoptotic process
Source: UniProtKB
Inferred from direct assayⁱ
- 18818310
positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway Source: Ensembl
positive regulation of transcription, DNA-templated
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 12663744
protein-containing complex assembly
Source: UniProtKB
Inferred from direct assayⁱ
- 19505873
regulation of mitotic cell cycle phase transition
Source: UniProtKB
Inferred from direct assayⁱ
- 18818310
regulation of transcription by RNA polymerase II
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Activator, DNA-binding
Biological process	Transcription, Transcription regulation

Enzyme and pathway databases

SIGNORⁱ	Q01664

SIGNORⁱ

Q01664

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Transcription factor AP-4 Alternative name(s): Activating enhancer-binding protein 4 Class C basic helix-loop-helix protein 41 Short name: bHLHc41
Gene namesⁱ	Name:TFAP4 Synonyms:BHLHC41
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 16

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000090447.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11745 TFAP4
MIMⁱ	600743 gene
neXtProtⁱ	NX_Q01664

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	7023
Open Targets More...OpenTargetsⁱ	ENSG00000090447
PharmGKBⁱ	PA36462

Polymorphism and mutation databases

BioMutaⁱ	TFAP4
DMDMⁱ	1729833

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000127458	1 – 338	Transcription factor AP-4Add BLAST		338

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	123	PhosphoserineCombined sources	1
Modified residueⁱ	124	PhosphoserineCombined sources	1
Modified residueⁱ	139	PhosphoserineCombined sources	1
Cross-linkⁱ	147	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linkⁱ	187	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linkⁱ	189	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linkⁱ	285	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMⁱ

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	Q01664
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q01664
PaxDbⁱ	Q01664
PeptideAtlas More...PeptideAtlasⁱ	Q01664
PRIDEⁱ	Q01664
ProteomicsDBⁱ	57980

PTM databases

iPTMnetⁱ	Q01664
PhosphoSitePlusⁱ	Q01664

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000090447 Expressed in 210 organ(s), highest expression level in cingulate cortex
CleanExⁱ	HS_TFAP4
ExpressionAtlasⁱ	Q01664 baseline and differential
Genevisibleⁱ	Q01664 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA001912

HPAⁱ

HPA001912

Interactionⁱ

Subunit structureⁱ

Efficient DNA binding requires dimerization with another bHLH protein. Homodimer.

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
EXOSC8	Q96B26	5	EBI-2514218,EBI-371922
GEM	P55040	2	EBI-2514218,EBI-744104
GOLGA2	Q08379	5	EBI-2514218,EBI-618309
TRAF1	Q13077	3	EBI-2514218,EBI-359224

GO - Molecular functionⁱ

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	112881, 115 interactors
Database of interacting proteins More...DIPⁱ	DIP-53627N
IntActⁱ	Q01664, 26 interactors
Molecular INTeraction database More...MINTⁱ	Q01664
STRINGⁱ	9606.ENSP00000204517

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q01664
SMRⁱ	Q01664
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	48 – 99	bHLHPROSITE-ProRule annotationAdd BLAST		52

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	100 – 120	Leucine-zipper 1Add BLAST		21
Regionⁱ	151 – 179	Leucine-zipper 2Add BLAST		29

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	193 – 222	Gln-richAdd BLAST		30
Compositional biasⁱ	225 – 244	Pro-richAdd BLAST		20

Keywords - Domainⁱ

Repeat

Phylogenomic databases

eggNOGⁱ	KOG0561 Eukaryota ENOG4111JPE LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000015189
HOGENOMⁱ	HOG000294087
HOVERGENⁱ	HBG061473
InParanoidⁱ	Q01664
KEGG Orthology (KO) More...KOⁱ	K09108
OMAⁱ	HHVNVVT
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G194I
PhylomeDBⁱ	Q01664
TreeFamⁱ	TF316489

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00083 HLH, 1 hit
Gene3Dⁱ	4.10.280.10, 1 hit
InterProⁱ	View protein in InterPro IPR011598 bHLH_dom IPR036638 HLH_DNA-bd_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00010 HLH, 1 hit
SMARTⁱ	View protein in SMART SM00353 HLH, 1 hit
SUPFAMⁱ	SSF47459 SSF47459, 1 hit
PROSITEⁱ	View protein in PROSITE PS50888 BHLH, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q01664-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MEYFMVPTQK VPSLQHFRKT EKEVIGGLCS LANIPLTPET QRDQERRIRR 
        60         70         80         90        100
EIANSNERRR MQSINAGFQS LKTLIPHTDG EKLSKAAILQ QTAEYIFSLE 
       110        120        130        140        150
QEKTRLLQQN TQLKRFIQEL SGSSPKRRRA EDKDEGIGSP DIWEDEKAED 
       160        170        180        190        200
LRREMIELRQ QLDKERSVRM MLEEQVRSLE AHMYPEKLKV IAQQVQLQQQ 
       210        220        230        240        250
QEQVRLLHQE KLEREQQQLR TQLLPPPAPT HHPTVIVPAP PPPPSHHINV 
       260        270        280        290        300
VTMGPSSVIN SVSTSRQNLD TIVQAIQHIE GTQEKQELEE EQRRAVIVKP 
       310        320        330 
VRSCPEAPTS DTASDSEASD SDAMDQSREE PSGDGELP

Length:338

Mass (Da):38,726

Last modified:October 1, 1996 - v2

Checksum:ⁱ540C008658596B83

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

I3L254	I3L254_HUMAN	Transcription factor AP-4 Transcription factor AP-4	TFAP4	115	Annotation score:
I3L301	I3L301_HUMAN	Transcription factor AP-4 Transcription factor AP-4	TFAP4	167	Annotation score:
I3L4L6	I3L4L6_HUMAN	Transcription factor AP-4 Transcription factor AP-4	TFAP4	44	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_059346	218	Q → H1 PublicationCorresponds to variant dbSNP:rs251732Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	S73885 mRNA Translation: AAB32235.1 AC004653 Genomic DNA Translation: AAC17116.1 BC010576 mRNA Translation: AAH10576.1 X57435 mRNA Translation: CAA40683.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10510.1
PIRⁱ	I56893
NCBI Reference Sequences More...RefSeqⁱ	NP_003214.1, NM_003223.2
UniGeneⁱ	Hs.513305

Genome annotation databases

Ensemblⁱ	ENST00000204517; ENSP00000204517; ENSG00000090447
GeneIDⁱ	7023
KEGGⁱ	hsa:7023
UCSC genome browser More...UCSCⁱ	uc010uxg.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q01664	Uncharacterized protein		MONDO		347	UniRef90_Q01664
Uncharacterized protein		SARHA		346
transcription factor AP-4 isoform X1		BALAS		342
transcription factor AP-4 isoform X1		DELLE		342
Uncharacterized protein		CAVPO		339
+120

Protein	Similar proteins		Species	Score	Length	Source
Q01664	Uncharacterized protein		MONDO		347	UniRef50_Q01664
Uncharacterized protein		SARHA		346
transcription factor AP-4 isoform X1		BALAS		342
transcription factor AP-4 isoform X1		DELLE		342
Transcription factor AP-4 (Fragment)		MUSPF		339
+302

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	S73885 mRNA Translation: AAB32235.1 AC004653 Genomic DNA Translation: AAC17116.1 BC010576 mRNA Translation: AAH10576.1 X57435 mRNA Translation: CAA40683.1
CCDSⁱ	CCDS10510.1
PIRⁱ	I56893
RefSeqⁱ	NP_003214.1, NM_003223.2
UniGeneⁱ	Hs.513305

3D structure databases

ProteinModelPortalⁱ	Q01664
SMRⁱ	Q01664
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112881, 115 interactors
DIPⁱ	DIP-53627N
IntActⁱ	Q01664, 26 interactors
MINTⁱ	Q01664
STRINGⁱ	9606.ENSP00000204517

PTM databases

iPTMnetⁱ	Q01664
PhosphoSitePlusⁱ	Q01664

Polymorphism and mutation databases

BioMutaⁱ	TFAP4
DMDMⁱ	1729833

Proteomic databases

EPDⁱ	Q01664
MaxQBⁱ	Q01664
PaxDbⁱ	Q01664
PeptideAtlasⁱ	Q01664
PRIDEⁱ	Q01664
ProteomicsDBⁱ	57980

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	7023
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000204517; ENSP00000204517; ENSG00000090447
GeneIDⁱ	7023
KEGGⁱ	hsa:7023
UCSCⁱ	uc010uxg.3 human

Organism-specific databases

CTDⁱ	7023
DisGeNETⁱ	7023
EuPathDBⁱ	HostDB:ENSG00000090447.11
GeneCardsⁱ	TFAP4
HGNCⁱ	HGNC:11745 TFAP4
HPAⁱ	HPA001912
MIMⁱ	600743 gene
neXtProtⁱ	NX_Q01664
OpenTargetsⁱ	ENSG00000090447
PharmGKBⁱ	PA36462
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0561 Eukaryota ENOG4111JPE LUCA
GeneTreeⁱ	ENSGT00390000015189
HOGENOMⁱ	HOG000294087
HOVERGENⁱ	HBG061473
InParanoidⁱ	Q01664
KOⁱ	K09108
OMAⁱ	HHVNVVT
OrthoDBⁱ	EOG091G194I
PhylomeDBⁱ	Q01664
TreeFamⁱ	TF316489

Enzyme and pathway databases

SIGNORⁱ	Q01664

SIGNORⁱ

Q01664

Miscellaneous databases

GeneWikiⁱ	TFAP4
GenomeRNAiⁱ	7023
Protein Ontology More...PROⁱ	PR:Q01664
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000090447 Expressed in 210 organ(s), highest expression level in cingulate cortex
CleanExⁱ	HS_TFAP4
ExpressionAtlasⁱ	Q01664 baseline and differential
Genevisibleⁱ	Q01664 HS

Family and domain databases

CDDⁱ	cd00083 HLH, 1 hit
Gene3Dⁱ	4.10.280.10, 1 hit
InterProⁱ	View protein in InterPro IPR011598 bHLH_dom IPR036638 HLH_DNA-bd_sf
Pfamⁱ	View protein in Pfam PF00010 HLH, 1 hit
SMARTⁱ	View protein in SMART SM00353 HLH, 1 hit
SUPFAMⁱ	SSF47459 SSF47459, 1 hit
PROSITEⁱ	View protein in PROSITE PS50888 BHLH, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TFAP4_HUMAN
Accessionⁱ	Q01664Primary (citable) accession number: Q01664 Secondary accession number(s): O60409
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1993
	Last sequence update:	October 1, 1996
	Last modified:	November 7, 2018
	This is version 178 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 16
Human chromosome 16: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q01664 (TFAP4_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Transcription factor AP-4

TFAP4

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Mitochondrion

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Compositional bias

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ