Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (07 Oct 2020)
Sequence version 4 (03 May 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Testis-specific Y-encoded protein 1

Gene

TSPY1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in sperm differentiation and proliferation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Gonadal differentiation, Spermatogenesis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q01534

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q01534

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Testis-specific Y-encoded protein 1
Alternative name(s):
Cancer/testis antigen 78
Short name:
CT78
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSPY1
Synonyms:TSPY
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome Y

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000258992.5

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12381, TSPY1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
480100, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q01534

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

TSPY is located in the gonadoblastoma critical region and is preferentially expressed in tumor germ cells of gonadoblastoma specimens. Expression also correlates with testicular seminoma and tumorigenesis of the prostate gland.3 Publications

Organism-specific databases

DisGeNET

More...
DisGeNETi
100289087
7258
728137

MalaCards human disease database

More...
MalaCardsi
TSPY1

Open Targets

More...
OpenTargetsi
ENSG00000258992

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
1646, Partial chromosome Y deletion

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165791579

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q01534, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TSPY1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
332278243

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001856681 – 308Testis-specific Y-encoded protein 1Add BLAST308

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q01534

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q01534

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q01534

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q01534

PeptideAtlas

More...
PeptideAtlasi
Q01534

PRoteomics IDEntifications database

More...
PRIDEi
Q01534

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
57966 [Q01534-1]
57967 [Q01534-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q01534

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q01534

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in testicular tissues. Isoform 1 and isoform 2 are expressed in spermatogonia and spermatocytes. Found in early testicular carcinoma in situ, spermatogonial cells in testicular tissues of 46,X,Y female and in prostate cancer cell lines.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected in 22-week old testis.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by androgen in a prostate cancer cell line.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000258992, Expressed in testis and 12 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q01534, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000258992, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
113109, 6 interactors
608573, 2 interactors
940742, 2 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q01534

Database of interacting proteins

More...
DIPi
DIP-46607N

Protein interaction database and analysis system

More...
IntActi
Q01534, 4 interactors

Molecular INTeraction database

More...
MINTi
Q01534

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q01534, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q01534

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162417

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q01534

KEGG Orthology (KO)

More...
KOi
K11284

Identification of Orthologs from Complete Genome Data

More...
OMAi
KEYANIN

Database of Orthologous Groups

More...
OrthoDBi
1191764at2759

TreeFam database of animal gene trees

More...
TreeFami
TF313386

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037231, NAP-like_sf
IPR002164, NAP_family

The PANTHER Classification System

More...
PANTHERi
PTHR11875, PTHR11875, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00956, NAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF143113, SSF143113, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q01534-1) [UniParc]FASTAAdd to basket
Also known as: Short, TSPY-S

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPEGSLTYR VPERLRQGFC GVGRAAQALV CASAKEGTAF RMEAVQEGAA
60 70 80 90 100
GVESEQAALG EEAVLLLDDI MAEVEVVAEE EGLVERREEA QRAQQAVPGP
110 120 130 140 150
GPMTPESAPE ELLAVQVELE PVNAQARKAF SRQREKMERR RKPHLDRRGA
160 170 180 190 200
VIQSVPGFWA NVIANHPQMS ALITDEDEDM LSYMVSLEVG EEKHPVHLCK
210 220 230 240 250
IMLFFRSNPY FQNKVITKEY LVNITEYRAS HSTPIEWYPD YEVEAYRRRH
260 270 280 290 300
HNSSLNFFNW FSDHNFAGSN KIAEILCKDL WRNPLQYYKR MKPPEEGTET

SGDSQLLS
Length:308
Mass (Da):35,012
Last modified:May 3, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5BDF0770F0B400A2
GO
Isoform 2 (identifier: Q01534-2) [UniParc]FASTAAdd to basket
Also known as: Long, TSPY-L

The sequence of this isoform differs from the canonical sequence as follows:
     275-308: ILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS → SPDRSYVRTCGAIPCNTTRG

Show »
Length:294
Mass (Da):33,169
Checksum:iD00764D1DB24339A
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA36570 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAA61238 differs from that shown. Probable unspliced transcript.Curated
The sequence CAA29640 differs from that shown. Sequence of unknown origin inserted in the coding sequence.Curated
The sequence X74029 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2 – 3RP → PA in X74029 (PubMed:8244388).Curated2
Sequence conflicti92 – 93RA → PR in AAB51693 (PubMed:8923009).Curated2
Sequence conflicti92 – 93RA → PR in AAD47421 (PubMed:10773691).Curated2
Sequence conflicti92 – 93RA → PR in AAA36570 (PubMed:1284595).Curated2
Sequence conflicti109P → L in AAB51693 (PubMed:8923009).Curated1
Sequence conflicti109P → L in AAD47421 (PubMed:10773691).Curated1
Sequence conflicti109P → L in AAI21115 (PubMed:15489334).Curated1
Sequence conflicti109P → L in AAA36570 (PubMed:1284595).Curated1
Sequence conflicti190G → E in AAB51693 (PubMed:8923009).Curated1
Sequence conflicti190G → E in AAD47421 (PubMed:10773691).Curated1
Sequence conflicti190G → E in AAI21115 (PubMed:15489334).Curated1
Sequence conflicti190G → E in AAA36570 (PubMed:1284595).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Variants Val-Glu-Val-Val-Ala-Glu-79 Ins and Arg-195 are shown to be present in a number of TSPY1 copies of the Yp11 loci. Variant Arg-195 is shown to be present at least in one TSPY1 copy of the Yq locus.
Maps to a tandemly repeated region on chromosome Yp11; additionally at least one copy is reported originating from Yq. The gene is thought to be present with an inter-individual variation in copy number and between 20 and 60 copies per Y chromosome are expected. PubMed:12815422 reports 35 tandemly repeated gene copies on Yp11 originating from one individual.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01622679E → EVEVVAE. 1
Natural variantiVAR_016227195P → R2 Publications1
Natural variantiVAR_016228216I → F1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_008012275 – 308ILCKD…SQLLS → SPDRSYVRTCGAIPCNTTRG in isoform 2. CuratedAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U58096 mRNA Translation: AAB51693.1
AF106331 Genomic DNA Translation: AAD47421.1
AC006156 Genomic DNA No translation available.
BC121114 mRNA Translation: AAI21115.1
X74029 Genomic DNA No translation available.
M94893 mRNA Translation: AAA61238.1 Sequence problems.
M98524 Genomic DNA No translation available.
M98525 mRNA Translation: AAA36570.1 Different initiation.
X06325 Genomic DNA Translation: CAA29640.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48205.1 [Q01534-1]
CCDS76071.1 [Q01534-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A27293
A40571
I54327

NCBI Reference Sequences

More...
RefSeqi
NP_001071165.2, NM_001077697.2
NP_001184171.1, NM_001197242.2 [Q01534-2]
NP_001269398.1, NM_001282469.2
NP_003299.2, NM_003308.4 [Q01534-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000423647; ENSP00000389324; ENSG00000258992 [Q01534-2]
ENST00000451548; ENSP00000403304; ENSG00000258992 [Q01534-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100289087
7258
728137

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100289087
hsa:7258
hsa:728137

UCSC genome browser

More...
UCSCi
uc004frw.5, human [Q01534-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U58096 mRNA Translation: AAB51693.1
AF106331 Genomic DNA Translation: AAD47421.1
AC006156 Genomic DNA No translation available.
BC121114 mRNA Translation: AAI21115.1
X74029 Genomic DNA No translation available.
M94893 mRNA Translation: AAA61238.1 Sequence problems.
M98524 Genomic DNA No translation available.
M98525 mRNA Translation: AAA36570.1 Different initiation.
X06325 Genomic DNA Translation: CAA29640.1 Sequence problems.
CCDSiCCDS48205.1 [Q01534-1]
CCDS76071.1 [Q01534-2]
PIRiA27293
A40571
I54327
RefSeqiNP_001071165.2, NM_001077697.2
NP_001184171.1, NM_001197242.2 [Q01534-2]
NP_001269398.1, NM_001282469.2
NP_003299.2, NM_003308.4 [Q01534-1]

3D structure databases

SMRiQ01534
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113109, 6 interactors
608573, 2 interactors
940742, 2 interactors
CORUMiQ01534
DIPiDIP-46607N
IntActiQ01534, 4 interactors
MINTiQ01534

PTM databases

iPTMnetiQ01534
PhosphoSitePlusiQ01534

Polymorphism and mutation databases

BioMutaiTSPY1
DMDMi332278243

Proteomic databases

jPOSTiQ01534
MassIVEiQ01534
MaxQBiQ01534
PaxDbiQ01534
PeptideAtlasiQ01534
PRIDEiQ01534
ProteomicsDBi57966 [Q01534-1]
57967 [Q01534-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
65589, 161 antibodies

Genome annotation databases

EnsembliENST00000423647; ENSP00000389324; ENSG00000258992 [Q01534-2]
ENST00000451548; ENSP00000403304; ENSG00000258992 [Q01534-1]
GeneIDi100289087
7258
728137
KEGGihsa:100289087
hsa:7258
hsa:728137
UCSCiuc004frw.5, human [Q01534-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100289087
7258
728137
DisGeNETi100289087
7258
728137
EuPathDBiHostDB:ENSG00000258992.5

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TSPY1
HGNCiHGNC:12381, TSPY1
HPAiENSG00000258992, Tissue enriched (testis)
MalaCardsiTSPY1
MIMi480100, gene
neXtProtiNX_Q01534
OpenTargetsiENSG00000258992
Orphaneti1646, Partial chromosome Y deletion
PharmGKBiPA165791579

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000162417
InParanoidiQ01534
KOiK11284
OMAiKEYANIN
OrthoDBi1191764at2759
TreeFamiTF313386

Enzyme and pathway databases

PathwayCommonsiQ01534
SIGNORiQ01534

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
100289087, 0 hits in 19 CRISPR screens
7258, 11 hits in 446 CRISPR screens
728137, 1 hit in 75 CRISPR screens
PharosiQ01534, Tbio

Protein Ontology

More...
PROi
PR:Q01534
RNActiQ01534, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000258992, Expressed in testis and 12 other tissues
GenevisibleiQ01534, HS

Family and domain databases

InterProiView protein in InterPro
IPR037231, NAP-like_sf
IPR002164, NAP_family
PANTHERiPTHR11875, PTHR11875, 1 hit
PfamiView protein in Pfam
PF00956, NAP, 1 hit
SUPFAMiSSF143113, SSF143113, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTSPY1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q01534
Secondary accession number(s): A6NJD2
, O00216, P09002, Q0VAD3, Q9UNN7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: May 3, 2011
Last modified: October 7, 2020
This is version 189 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again