Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - Q01344 (IL5RA_HUMAN)

Entry version 204 (25 May 2022)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Interleukin-5 receptor subunit alpha

Gene

IL5RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is the receptor for interleukin-5. The alpha chain binds to IL5.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q01344

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-512988, Interleukin-3, Interleukin-5 and GM-CSF signaling
R-HSA-5673001, RAF/MAP kinase cascade
R-HSA-912526, Interleukin receptor SHC signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q01344

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q01344

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-5 receptor subunit alpha
Short name:
IL-5 receptor subunit alpha
Short name:
IL-5R subunit alpha
Short name:
IL-5R-alpha
Short name:
IL-5RA
Alternative name(s):
CDw125
CD_antigen: CD125
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL5RA
Synonyms:IL5R
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6017, IL5RA

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		147851, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q01344

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000091181

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini21 – 342ExtracellularSequence analysisAdd BLAST322
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei343 – 362HelicalSequence analysisAdd BLAST20
Topological domaini363 – 420CytoplasmicSequence analysisAdd BLAST58

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3568

Open Targets

More...OpenTargetsi		ENSG00000091181

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29834

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q01344, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3580483

Drug and drug target database

More...DrugBanki		DB12023, Benralizumab

DrugCentral

More...DrugCentrali		Q01344

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1706

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		IL5RA

Domain mapping of disease mutations (DMDM)

More...DMDMi		116242525

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Add BLAST20
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001089321 – 420Interleukin-5 receptor subunit alphaAdd BLAST400

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi35N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi131N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi134 ↔ 1551 Publication
Disulfide bondi182 ↔ 1961 Publication
Glycosylationi216N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi244N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi269 ↔ 3161 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q01344

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q01344

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q01344

PeptideAtlas

More...PeptideAtlasi		Q01344

PRoteomics IDEntifications database

More...PRIDEi		Q01344

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q01344, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q01344

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q01344

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed on eosinophils and basophils.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000091181, Expressed in right uterine tube and 108 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q01344, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q01344, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000091181, Tissue enhanced (brain, choroid plexus, fallopian tube)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors.

Interacts with SDCBP.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109782, 143 interactors

Database of interacting proteins

More...DIPi		DIP-3510N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q01344

Protein interaction database and analysis system

More...IntActi		Q01344, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000412209

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q01344, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1420
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q01344

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q01344

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q01344

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 123Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST92
Domaini241 – 334Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi322 – 326WSXWS motif5
Motifi371 – 379Box 1 motif9

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the type I cytokine receptor family. Type 5 subfamily.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QZNV, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160890

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_039945_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q01344

Identification of Orthologs from Complete Genome Data

More...OMAi		HAIDQVN

Database of Orthologous Groups

More...OrthoDBi		1151666at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q01344

TreeFam database of animal gene trees

More...TreeFami		TF331549

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
IPR003532, Short_hematopoietin_rcpt_2_CS
IPR015321, TypeI_recpt_CBD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09240, IL6Ra-bind, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49265, SSF49265, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50853, FN3, 2 hits
PS01356, HEMATOPO_REC_S_F2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q01344-1) [UniParc]FASTAAdd to basket
Also known as: Membrane-bound

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIIVAHVLLI LLGATEILQA DLLPDEKISL LPPVNFTIKV TGLAQVLLQW 
        60         70         80         90        100
KPNPDQEQRN VNLEYQVKIN APKEDDYETR ITESKCVTIL HKGFSASVRT 
       110        120        130        140        150
ILQNDHSLLA SSWASAELHA PPGSPGTSIV NLTCTTNTTE DNYSRLRSYQ 
       160        170        180        190        200
VSLHCTWLVG TDAPEDTQYF LYYRYGSWTE ECQEYSKDTL GRNIACWFPR 
       210        220        230        240        250
TFILSKGRDW LAVLVNGSSK HSAIRPFDQL FALHAIDQIN PPLNVTAEIE 
       260        270        280        290        300
GTRLSIQWEK PVSAFPIHCF DYEVKIHNTR NGYLQIEKLM TNAFISIIDD 
       310        320        330        340        350
LSKYDVQVRA AVSSMCREAG LWSEWSQPIY VGNDEHKPLR EWFVIVIMAT 
       360        370        380        390        400
ICFILLILSL ICKICHLWIK LFPPIPAPKS NIKDLFVTTN YEKAGSSETE 
       410        420
IEVICYIEKP GVETLEDSVF
Length:420
Mass (Da):47,685
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4E0A5F2838B9C4FE
GO
Isoform 2 (identifier: Q01344-2) [UniParc]FASTAAdd to basket
Also known as: Soluble-S1

The sequence of this isoform differs from the canonical sequence as follows:
     333-335: NDE → FSR
     336-420: Missing.

Show »
Length:335
Mass (Da):37,984
Checksum:iBAED076239845E16
GO
Isoform 3 (identifier: Q01344-3) [UniParc]FASTAAdd to basket
Also known as: Soluble-S2

The sequence of this isoform differs from the canonical sequence as follows:
     333-333: N → K
     334-420: Missing.

Show »
Length:333
Mass (Da):37,722
Checksum:i8D9239845E16985B
GO
Isoform 4 (identifier: Q01344-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-420: CHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF → KLGPVRRKLKSSVI

Show »
Length:378
Mass (Da):42,924
Checksum:i3044C8640A83F586
GO
Isoform 5 (identifier: Q01344-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-331: Missing.

Show »
Length:211
Mass (Da):23,737
Checksum:i475CB1AB3BF8D2B2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERY4E7ERY4_HUMAN
Interleukin-5 receptor subunit alph...
IL5RA
325Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6C4C9J6C4_HUMAN
Interleukin-5 receptor subunit alph...
IL5RA
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3K8C9J3K8_HUMAN
Interleukin-5 receptor subunit alph...
IL5RA
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti212A → S in AAA36110 (PubMed:1833065).Curated1
Sequence conflicti212A → S in AAA59151 (PubMed:1732409).Curated1
Sequence conflicti212A → S in AAA59152 (PubMed:1732409).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020654129I → V2 PublicationsCorresponds to variant dbSNP:rs2290610Ensembl.1
Natural variantiVAR_020655262V → A1 PublicationCorresponds to variant dbSNP:rs17879690Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047762123 – 331Missing in isoform 5. 1 PublicationAdd BLAST209
Alternative sequenceiVSP_001678333 – 335NDE → FSR in isoform 2. 1 Publication3
Alternative sequenceiVSP_001680333N → K in isoform 3. 2 Publications1
Alternative sequenceiVSP_001681334 – 420Missing in isoform 3. 2 PublicationsAdd BLAST87
Alternative sequenceiVSP_001679336 – 420Missing in isoform 2. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_046742365 – 420CHLWI…EDSVF → KLGPVRRKLKSSVI in isoform 4. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M75914 mRNA Translation: AAA36110.1
X61176 mRNA Translation: CAA43483.1
X62156 mRNA Translation: CAA44081.1
M96651 mRNA Translation: AAA59151.1
M96652 mRNA Translation: AAA59152.1
AB288090 mRNA Translation: BAG49562.1
AK304256 mRNA Translation: BAG65122.1
AY642135 Genomic DNA Translation: AAT45457.1
AC022002 Genomic DNA No translation available.
AC024060 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2559.1 [Q01344-1]
CCDS2560.1 [Q01344-2]
CCDS46739.1 [Q01344-3]
CCDS58813.1 [Q01344-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A40267

NCBI Reference Sequences

More...RefSeqi		NP_000555.2, NM_000564.4 [Q01344-1]
NP_001230028.1, NM_001243099.1 [Q01344-4]
NP_783851.1, NM_175724.2 [Q01344-3]
NP_783852.1, NM_175725.2 [Q01344-2]
NP_783853.1, NM_175726.3 [Q01344-1]
NP_783854.1, NM_175727.2 [Q01344-3]
NP_783855.1, NM_175728.2 [Q01344-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000256452.7; ENSP00000256452.3; ENSG00000091181.20
ENST00000311981.12; ENSP00000309196.8; ENSG00000091181.20 [Q01344-2]
ENST00000383846.5; ENSP00000373358.1; ENSG00000091181.20 [Q01344-2]
ENST00000430514.6; ENSP00000400400.2; ENSG00000091181.20 [Q01344-3]
ENST00000438560.5; ENSP00000390753.1; ENSG00000091181.20 [Q01344-4]
ENST00000446632.7; ENSP00000412209.2; ENSG00000091181.20
ENST00000456302.5; ENSP00000392059.1; ENSG00000091181.20 [Q01344-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3568

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3568

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000446632.7; ENSP00000412209.2; NM_175726.4; NP_783853.1

UCSC genome browser

More...UCSCi		uc010hbs.4, human [Q01344-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M75914 mRNA Translation: AAA36110.1
X61176 mRNA Translation: CAA43483.1
X62156 mRNA Translation: CAA44081.1
M96651 mRNA Translation: AAA59151.1
M96652 mRNA Translation: AAA59152.1
AB288090 mRNA Translation: BAG49562.1
AK304256 mRNA Translation: BAG65122.1
AY642135 Genomic DNA Translation: AAT45457.1
AC022002 Genomic DNA No translation available.
AC024060 Genomic DNA No translation available.
CCDSiCCDS2559.1 [Q01344-1]
CCDS2560.1 [Q01344-2]
CCDS46739.1 [Q01344-3]
CCDS58813.1 [Q01344-4]
PIRiA40267
RefSeqiNP_000555.2, NM_000564.4 [Q01344-1]
NP_001230028.1, NM_001243099.1 [Q01344-4]
NP_783851.1, NM_175724.2 [Q01344-3]
NP_783852.1, NM_175725.2 [Q01344-2]
NP_783853.1, NM_175726.3 [Q01344-1]
NP_783854.1, NM_175727.2 [Q01344-3]
NP_783855.1, NM_175728.2 [Q01344-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OBXX-ray1.35B413-420[»]
1OBZX-ray1.69P413-420[»]
3QT2X-ray2.55A/B20-335[»]
3VA2X-ray2.70C21-335[»]
6H41X-ray2.75A27-332[»]
AlphaFoldDBiQ01344
SMRiQ01344
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109782, 143 interactors
DIPiDIP-3510N
ELMiQ01344
IntActiQ01344, 6 interactors
STRINGi9606.ENSP00000412209

Chemistry databases

ChEMBLiCHEMBL3580483
DrugBankiDB12023, Benralizumab
DrugCentraliQ01344
GuidetoPHARMACOLOGYi1706

PTM databases

GlyGeniQ01344, 4 sites
iPTMnetiQ01344
PhosphoSitePlusiQ01344

Genetic variation databases

BioMutaiIL5RA
DMDMi116242525

Proteomic databases

MassIVEiQ01344
MaxQBiQ01344
PaxDbiQ01344
PeptideAtlasiQ01344
PRIDEiQ01344

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q01344, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2274, 411 antibodies from 34 providers

The DNASU plasmid repository

More...DNASUi		3568

Genome annotation databases

EnsembliENST00000256452.7; ENSP00000256452.3; ENSG00000091181.20
ENST00000311981.12; ENSP00000309196.8; ENSG00000091181.20 [Q01344-2]
ENST00000383846.5; ENSP00000373358.1; ENSG00000091181.20 [Q01344-2]
ENST00000430514.6; ENSP00000400400.2; ENSG00000091181.20 [Q01344-3]
ENST00000438560.5; ENSP00000390753.1; ENSG00000091181.20 [Q01344-4]
ENST00000446632.7; ENSP00000412209.2; ENSG00000091181.20
ENST00000456302.5; ENSP00000392059.1; ENSG00000091181.20 [Q01344-3]
GeneIDi3568
KEGGihsa:3568
MANE-SelectiENST00000446632.7; ENSP00000412209.2; NM_175726.4; NP_783853.1
UCSCiuc010hbs.4, human [Q01344-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3568
DisGeNETi3568

GeneCards: human genes, protein and diseases

More...GeneCardsi		IL5RA
HGNCiHGNC:6017, IL5RA
HPAiENSG00000091181, Tissue enhanced (brain, choroid plexus, fallopian tube)
MIMi147851, gene
neXtProtiNX_Q01344
OpenTargetsiENSG00000091181
PharmGKBiPA29834
VEuPathDBiHostDB:ENSG00000091181

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QZNV, Eukaryota
GeneTreeiENSGT00940000160890
HOGENOMiCLU_039945_0_0_1
InParanoidiQ01344
OMAiHAIDQVN
OrthoDBi1151666at2759
PhylomeDBiQ01344
TreeFamiTF331549

Enzyme and pathway databases

PathwayCommonsiQ01344
ReactomeiR-HSA-512988, Interleukin-3, Interleukin-5 and GM-CSF signaling
R-HSA-5673001, RAF/MAP kinase cascade
R-HSA-912526, Interleukin receptor SHC signaling
SignaLinkiQ01344
SIGNORiQ01344

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3568, 9 hits in 1061 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		IL5RA, human
EvolutionaryTraceiQ01344

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Interleukin_5_receptor_alpha_subunit

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3568
PharosiQ01344, Tclin

Protein Ontology

More...PROi		PR:Q01344
RNActiQ01344, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000091181, Expressed in right uterine tube and 108 other tissues
ExpressionAtlasiQ01344, baseline and differential
GenevisibleiQ01344, HS

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
IPR003532, Short_hematopoietin_rcpt_2_CS
IPR015321, TypeI_recpt_CBD
PfamiView protein in Pfam
PF09240, IL6Ra-bind, 1 hit
SUPFAMiSSF49265, SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853, FN3, 2 hits
PS01356, HEMATOPO_REC_S_F2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL5RA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q01344
Secondary accession number(s): B3IU77
, B4E2G0, Q14633, Q15469, Q6ISX9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: October 17, 2006
Last modified: May 25, 2022
This is version 204 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again