Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-5 receptor subunit alpha

Gene

IL5RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is the receptor for interleukin-5. The alpha chain binds to IL5.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cytokine binding Source: GO_Central
  • cytokine receptor activity Source: GO_Central
  • interleukin-5 receptor activity Source: ProtInc
  • protein tyrosine kinase activity Source: Reactome
  • Ras guanyl-nucleotide exchange factor activity Source: Reactome

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-512988 Interleukin-3, Interleukin-5 and GM-CSF signaling
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-912526 Interleukin receptor SHC signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q01344

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q01344

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-5 receptor subunit alpha
Short name:
IL-5 receptor subunit alpha
Short name:
IL-5R subunit alpha
Short name:
IL-5R-alpha
Short name:
IL-5RA
Alternative name(s):
CDw125
CD_antigen: CD125
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL5RA
Synonyms:IL5R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000091181.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6017 IL5RA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
147851 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q01344

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini21 – 342ExtracellularSequence analysisAdd BLAST322
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei343 – 362HelicalSequence analysisAdd BLAST20
Topological domaini363 – 420CytoplasmicSequence analysisAdd BLAST58

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
3568

Open Targets

More...
OpenTargetsi
ENSG00000091181

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29834

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3580483

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1706

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IL5RA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242525

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Add BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001089321 – 420Interleukin-5 receptor subunit alphaAdd BLAST400

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi35N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi131N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi134 ↔ 1551 Publication
Disulfide bondi182 ↔ 1961 Publication
Glycosylationi216N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi244N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi269 ↔ 3161 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q01344

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q01344

PeptideAtlas

More...
PeptideAtlasi
Q01344

PRoteomics IDEntifications database

More...
PRIDEi
Q01344

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57939
57940 [Q01344-2]
57941 [Q01344-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q01344

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q01344

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed on eosinophils and basophils.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000091181 Expressed in 85 organ(s), highest expression level in right uterine tube

CleanEx database of gene expression profiles

More...
CleanExi
HS_IL5RA

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q01344 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q01344 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors. Interacts with SDCBP.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109782, 15 interactors

Database of interacting proteins

More...
DIPi
DIP-3510N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q01344

Protein interaction database and analysis system

More...
IntActi
Q01344, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000256452

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1420
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q01344

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q01344

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q01344

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 123Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST92
Domaini241 – 334Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi322 – 326WSXWS motif5
Motifi371 – 379Box 1 motif9

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ36 Eukaryota
ENOG4111ZG2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160890

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070224

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052117

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q01344

KEGG Orthology (KO)

More...
KOi
K05067

Identification of Orthologs from Complete Genome Data

More...
OMAi
YSIQVRA

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0B29

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q01344

TreeFam database of animal gene trees

More...
TreeFami
TF331549

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003532 Short_hematopoietin_rcpt_2_CS
IPR015321 TypeI_recpt_CBD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09240 IL6Ra-bind, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265 SSF49265, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 2 hits
PS01356 HEMATOPO_REC_S_F2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q01344-1) [UniParc]FASTAAdd to basket
Also known as: Membrane-bound

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIIVAHVLLI LLGATEILQA DLLPDEKISL LPPVNFTIKV TGLAQVLLQW
60 70 80 90 100
KPNPDQEQRN VNLEYQVKIN APKEDDYETR ITESKCVTIL HKGFSASVRT
110 120 130 140 150
ILQNDHSLLA SSWASAELHA PPGSPGTSIV NLTCTTNTTE DNYSRLRSYQ
160 170 180 190 200
VSLHCTWLVG TDAPEDTQYF LYYRYGSWTE ECQEYSKDTL GRNIACWFPR
210 220 230 240 250
TFILSKGRDW LAVLVNGSSK HSAIRPFDQL FALHAIDQIN PPLNVTAEIE
260 270 280 290 300
GTRLSIQWEK PVSAFPIHCF DYEVKIHNTR NGYLQIEKLM TNAFISIIDD
310 320 330 340 350
LSKYDVQVRA AVSSMCREAG LWSEWSQPIY VGNDEHKPLR EWFVIVIMAT
360 370 380 390 400
ICFILLILSL ICKICHLWIK LFPPIPAPKS NIKDLFVTTN YEKAGSSETE
410 420
IEVICYIEKP GVETLEDSVF
Length:420
Mass (Da):47,685
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4E0A5F2838B9C4FE
GO
Isoform 2 (identifier: Q01344-2) [UniParc]FASTAAdd to basket
Also known as: Soluble-S1

The sequence of this isoform differs from the canonical sequence as follows:
     333-335: NDE → FSR
     336-420: Missing.

Show »
Length:335
Mass (Da):37,984
Checksum:iBAED076239845E16
GO
Isoform 3 (identifier: Q01344-3) [UniParc]FASTAAdd to basket
Also known as: Soluble-S2

The sequence of this isoform differs from the canonical sequence as follows:
     333-333: N → K
     334-420: Missing.

Show »
Length:333
Mass (Da):37,722
Checksum:i8D9239845E16985B
GO
Isoform 4 (identifier: Q01344-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-420: CHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF → KLGPVRRKLKSSVI

Show »
Length:378
Mass (Da):42,924
Checksum:i3044C8640A83F586
GO
Isoform 5 (identifier: Q01344-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-331: Missing.

Show »
Length:211
Mass (Da):23,737
Checksum:i475CB1AB3BF8D2B2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERY4E7ERY4_HUMAN
Interleukin-5 receptor subunit alph...
IL5RA
325Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6C4C9J6C4_HUMAN
Interleukin-5 receptor subunit alph...
IL5RA
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3K8C9J3K8_HUMAN
Interleukin-5 receptor subunit alph...
IL5RA
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti212A → S in AAA36110 (PubMed:1833065).Curated1
Sequence conflicti212A → S in AAA59151 (PubMed:1732409).Curated1
Sequence conflicti212A → S in AAA59152 (PubMed:1732409).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020654129I → V2 PublicationsCorresponds to variant dbSNP:rs2290610Ensembl.1
Natural variantiVAR_020655262V → A1 PublicationCorresponds to variant dbSNP:rs17879690Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047762123 – 331Missing in isoform 5. 1 PublicationAdd BLAST209
Alternative sequenceiVSP_001678333 – 335NDE → FSR in isoform 2. 1 Publication3
Alternative sequenceiVSP_001680333N → K in isoform 3. 2 Publications1
Alternative sequenceiVSP_001681334 – 420Missing in isoform 3. 2 PublicationsAdd BLAST87
Alternative sequenceiVSP_001679336 – 420Missing in isoform 2. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_046742365 – 420CHLWI…EDSVF → KLGPVRRKLKSSVI in isoform 4. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M75914 mRNA Translation: AAA36110.1
X61176 mRNA Translation: CAA43483.1
X62156 mRNA Translation: CAA44081.1
M96651 mRNA Translation: AAA59151.1
M96652 mRNA Translation: AAA59152.1
AB288090 mRNA Translation: BAG49562.1
AK304256 mRNA Translation: BAG65122.1
AY642135 Genomic DNA Translation: AAT45457.1
AC022002 Genomic DNA No translation available.
AC024060 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2559.1 [Q01344-1]
CCDS2560.1 [Q01344-2]
CCDS46739.1 [Q01344-3]
CCDS58813.1 [Q01344-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A40267

NCBI Reference Sequences

More...
RefSeqi
NP_000555.2, NM_000564.4 [Q01344-1]
NP_001230028.1, NM_001243099.1 [Q01344-4]
NP_783851.1, NM_175724.2 [Q01344-3]
NP_783852.1, NM_175725.2 [Q01344-2]
NP_783853.1, NM_175726.3 [Q01344-1]
NP_783854.1, NM_175727.2 [Q01344-3]
NP_783855.1, NM_175728.2 [Q01344-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.68876

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000256452; ENSP00000256452; ENSG00000091181 [Q01344-1]
ENST00000311981; ENSP00000309196; ENSG00000091181 [Q01344-2]
ENST00000383846; ENSP00000373358; ENSG00000091181 [Q01344-2]
ENST00000430514; ENSP00000400400; ENSG00000091181 [Q01344-3]
ENST00000438560; ENSP00000390753; ENSG00000091181 [Q01344-4]
ENST00000446632; ENSP00000412209; ENSG00000091181 [Q01344-1]
ENST00000456302; ENSP00000392059; ENSG00000091181 [Q01344-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3568

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3568

UCSC genome browser

More...
UCSCi
uc010hbs.4 human [Q01344-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M75914 mRNA Translation: AAA36110.1
X61176 mRNA Translation: CAA43483.1
X62156 mRNA Translation: CAA44081.1
M96651 mRNA Translation: AAA59151.1
M96652 mRNA Translation: AAA59152.1
AB288090 mRNA Translation: BAG49562.1
AK304256 mRNA Translation: BAG65122.1
AY642135 Genomic DNA Translation: AAT45457.1
AC022002 Genomic DNA No translation available.
AC024060 Genomic DNA No translation available.
CCDSiCCDS2559.1 [Q01344-1]
CCDS2560.1 [Q01344-2]
CCDS46739.1 [Q01344-3]
CCDS58813.1 [Q01344-4]
PIRiA40267
RefSeqiNP_000555.2, NM_000564.4 [Q01344-1]
NP_001230028.1, NM_001243099.1 [Q01344-4]
NP_783851.1, NM_175724.2 [Q01344-3]
NP_783852.1, NM_175725.2 [Q01344-2]
NP_783853.1, NM_175726.3 [Q01344-1]
NP_783854.1, NM_175727.2 [Q01344-3]
NP_783855.1, NM_175728.2 [Q01344-2]
UniGeneiHs.68876

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OBXX-ray1.35B413-420[»]
1OBZX-ray1.69P413-420[»]
3QT2X-ray2.55A/B20-335[»]
3VA2X-ray2.70C21-335[»]
ProteinModelPortaliQ01344
SMRiQ01344
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109782, 15 interactors
DIPiDIP-3510N
ELMiQ01344
IntActiQ01344, 5 interactors
STRINGi9606.ENSP00000256452

Chemistry databases

ChEMBLiCHEMBL3580483
GuidetoPHARMACOLOGYi1706

PTM databases

iPTMnetiQ01344
PhosphoSitePlusiQ01344

Polymorphism and mutation databases

BioMutaiIL5RA
DMDMi116242525

Proteomic databases

MaxQBiQ01344
PaxDbiQ01344
PeptideAtlasiQ01344
PRIDEiQ01344
ProteomicsDBi57939
57940 [Q01344-2]
57941 [Q01344-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000256452; ENSP00000256452; ENSG00000091181 [Q01344-1]
ENST00000311981; ENSP00000309196; ENSG00000091181 [Q01344-2]
ENST00000383846; ENSP00000373358; ENSG00000091181 [Q01344-2]
ENST00000430514; ENSP00000400400; ENSG00000091181 [Q01344-3]
ENST00000438560; ENSP00000390753; ENSG00000091181 [Q01344-4]
ENST00000446632; ENSP00000412209; ENSG00000091181 [Q01344-1]
ENST00000456302; ENSP00000392059; ENSG00000091181 [Q01344-3]
GeneIDi3568
KEGGihsa:3568
UCSCiuc010hbs.4 human [Q01344-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3568
DisGeNETi3568
EuPathDBiHostDB:ENSG00000091181.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IL5RA
HGNCiHGNC:6017 IL5RA
MIMi147851 gene
neXtProtiNX_Q01344
OpenTargetsiENSG00000091181
PharmGKBiPA29834

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJ36 Eukaryota
ENOG4111ZG2 LUCA
GeneTreeiENSGT00940000160890
HOGENOMiHOG000070224
HOVERGENiHBG052117
InParanoidiQ01344
KOiK05067
OMAiYSIQVRA
OrthoDBiEOG091G0B29
PhylomeDBiQ01344
TreeFamiTF331549

Enzyme and pathway databases

ReactomeiR-HSA-512988 Interleukin-3, Interleukin-5 and GM-CSF signaling
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-912526 Interleukin receptor SHC signaling
SignaLinkiQ01344
SIGNORiQ01344

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IL5RA human
EvolutionaryTraceiQ01344

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Interleukin_5_receptor_alpha_subunit

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3568

Protein Ontology

More...
PROi
PR:Q01344

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000091181 Expressed in 85 organ(s), highest expression level in right uterine tube
CleanExiHS_IL5RA
ExpressionAtlasiQ01344 baseline and differential
GenevisibleiQ01344 HS

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003532 Short_hematopoietin_rcpt_2_CS
IPR015321 TypeI_recpt_CBD
PfamiView protein in Pfam
PF09240 IL6Ra-bind, 1 hit
SUPFAMiSSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS01356 HEMATOPO_REC_S_F2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL5RA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q01344
Secondary accession number(s): B3IU77
, B4E2G0, Q14633, Q15469, Q6ISX9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: October 17, 2006
Last modified: December 5, 2018
This is version 183 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again