Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-9 receptor

Gene

IL9R

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This is a receptor for interleukin-9.

Miscellaneous

The gene coding for this protein is located in the pseudoautosomal region 2 (PAR2) of X and Y chromosomes.

GO - Molecular functioni

  • interleukin-9 receptor activity Source: ProtInc

GO - Biological processi

  • cell proliferation Source: ProtInc
  • interleukin-9-mediated signaling pathway Source: Reactome
  • signal transduction Source: ProtInc

Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

ReactomeiR-HSA-8985947 Interleukin-9 signaling
SignaLinkiQ01113
SIGNORiQ01113

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-9 receptor
Short name:
IL-9 receptor
Short name:
IL-9R
Alternative name(s):
CD_antigen: CD129
Gene namesi
Name:IL9R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000124334.17
HGNCiHGNC:6030 IL9R
MIMi300007 gene
neXtProtiNX_Q01113

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini41 – 270ExtracellularSequence analysisAdd BLAST230
Transmembranei271 – 291HelicalSequence analysisAdd BLAST21
Topological domaini292 – 521CytoplasmicSequence analysisAdd BLAST230

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi3581
OpenTargetsiENSG00000124334
PharmGKBiPA29846

Polymorphism and mutation databases

BioMutaiIL9R
DMDMi116242526

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 40Sequence analysisAdd BLAST40
ChainiPRO_000001091141 – 521Interleukin-9 receptorAdd BLAST481

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi117N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi156N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ01113
PRIDEiQ01113
ProteomicsDBi57919
57920 [Q01113-2]

PTM databases

iPTMnetiQ01113
PhosphoSitePlusiQ01113

Expressioni

Gene expression databases

BgeeiENSG00000124334
CleanExiHS_IL9R
GenevisibleiQ01113 HS

Organism-specific databases

HPAiHPA063240
HPA064557

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAZP631045EBI-3910754,EBI-347088

Protein-protein interaction databases

BioGridi109795, 23 interactors
DIPiDIP-3156N
ELMiQ01113
IntActiQ01113, 2 interactors
MINTiQ01113
STRINGi9606.ENSP00000244174

Structurei

3D structure databases

ProteinModelPortaliQ01113
SMRiQ01113
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini149 – 259Fibronectin type-IIIPROSITE-ProRule annotationAdd BLAST111

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi245 – 249WSXWS motif5
Motifi301 – 309Box 1 motif9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi429 – 438Poly-Ser10
Compositional biasi439 – 442Poly-Asn4

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J4GJ Eukaryota
ENOG4111AX0 LUCA
GeneTreeiENSGT00510000049125
HOGENOMiHOG000095165
HOVERGENiHBG005032
InParanoidiQ01113
KOiK05073
OMAiWHLSALP
OrthoDBiEOG091G05XB
PhylomeDBiQ01113
TreeFamiTF337874

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR003531 Hempt_rcpt_S_F1_CS
IPR013783 Ig-like_fold
SUPFAMiSSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 1 hit
PS01355 HEMATOPO_REC_S_F1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q01113-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLGRCIWEG WTLESEALRR DMGTWLLACI CICTCVCLGV SVTGEGQGPR
60 70 80 90 100
SRTFTCLTNN ILRIDCHWSA PELGQGSSPW LLFTSNQAPG GTHKCILRGS
110 120 130 140 150
ECTVVLPPEA VLVPSDNFTI TFHHCMSGRE QVSLVDPEYL PRRHVKLDPP
160 170 180 190 200
SDLQSNISSG HCILTWSISP ALEPMTTLLS YELAFKKQEE AWEQAQHRDH
210 220 230 240 250
IVGVTWLILE AFELDPGFIH EARLRVQMAT LEDDVVEEER YTGQWSEWSQ
260 270 280 290 300
PVCFQAPQRQ GPLIPPWGWP GNTLVAVSIF LLLTGPTYLL FKLSPRVKRI
310 320 330 340 350
FYQNVPSPAM FFQPLYSVHN GNFQTWMGAH GAGVLLSQDC AGTPQGALEP
360 370 380 390 400
CVQEATALLT CGPARPWKSV ALEEEQEGPG TRLPGNLSSE DVLPAGCTEW
410 420 430 440 450
RVQTLAYLPQ EDWAPTSLTR PAPPDSEGSR SSSSSSSSNN NNYCALGCYG
460 470 480 490 500
GWHLSALPGN TQSSGPIPAL ACGLSCDHQG LETQQGVAWV LAGHCQRPGL
510 520
HEDLQGMLLP SVLSKARSWT F
Length:521
Mass (Da):57,147
Last modified:October 17, 2006 - v3
Checksum:i07C40436466173F3
GO
Isoform 2 (identifier: Q01113-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Show »
Length:500
Mass (Da):54,686
Checksum:iC79D0C8C1D330D8F
GO
Isoform 3 (identifier: Q01113-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MGLGRCIWE → MPQTCDGTGQMHLGSNCCKNGQTLLQRTCHGVSCCGWWFQAARSILGKGPSAQSLA
     85-154: SNQAPGGTHK...VKLDPPSDLQ → RLLAAHISAS...WTRSTCPGDT
     297-307: VKRIFYQNVPS → LGWGPTGPVCC
     308-521: Missing.

Show »
Length:342
Mass (Da):37,389
Checksum:iBC2E46EF83989332
GO

Sequence cautioni

The sequence AAB30844 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti438S → SS in AAA58679 (PubMed:1376929).Curated1
Sequence conflicti438S → SS in AAL55435 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03878463R → K1 PublicationCorresponds to variant dbSNP:rs3093495Ensembl.1
Natural variantiVAR_014804239E → Q1 PublicationCorresponds to variant dbSNP:rs6522Ensembl.1
Natural variantiVAR_033920288Y → C1 PublicationCorresponds to variant dbSNP:rs149119910Ensembl.1
Natural variantiVAR_055348331G → R2 PublicationsCorresponds to variant dbSNP:rs2230001Ensembl.1
Natural variantiVAR_055349365R → H. Corresponds to variant dbSNP:rs2228650Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0390251 – 21Missing in isoform 2. CuratedAdd BLAST21
Alternative sequenceiVSP_0462071 – 9MGLGRCIWE → MPQTCDGTGQMHLGSNCCKN GQTLLQRTCHGVSCCGWWFQ AARSILGKGPSAQSLA in isoform 3. Curated9
Alternative sequenceiVSP_04620885 – 154SNQAP…PSDLQ → RLLAAHISASCGAVSAPSCC HLRQCSCHLTISPSLSTTAC LGGSRSAWWTRSTCPGDT in isoform 3. CuratedAdd BLAST70
Alternative sequenceiVSP_046209297 – 307VKRIFYQNVPS → LGWGPTGPVCC in isoform 3. CuratedAdd BLAST11
Alternative sequenceiVSP_046210308 – 521Missing in isoform 3. CuratedAdd BLAST214

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84747 mRNA Translation: AAA58679.1
L39064 Genomic DNA Translation: AAC29513.1
AJ271736 Genomic DNA Translation: CAB96817.1
AY071830 Genomic DNA Translation: AAL55435.1
CH471247 Genomic DNA Translation: EAW55884.1
S71404 mRNA Translation: AAB30844.2 Different initiation.
S71420 Genomic DNA Translation: AAD14081.1
CCDSiCCDS14771.4 [Q01113-1]
CCDS59180.1 [Q01113-3]
PIRiB45268
RefSeqiNP_002177.2, NM_002186.2 [Q01113-1]
NP_789743.2, NM_176786.1 [Q01113-3]
XP_011529456.1, XM_011531154.2 [Q01113-2]
XP_011543951.1, XM_011545649.2 [Q01113-2]
XP_016884986.1, XM_017029497.1 [Q01113-2]
XP_016884987.1, XM_017029498.1 [Q01113-2]
XP_016884988.1, XM_017029499.1 [Q01113-2]
XP_016885535.1, XM_017030046.1 [Q01113-2]
XP_016885536.1, XM_017030047.1 [Q01113-2]
XP_016885537.1, XM_017030048.1 [Q01113-2]
UniGeneiHs.406228

Genome annotation databases

EnsembliENST00000244174; ENSP00000244174; ENSG00000124334 [Q01113-1]
ENST00000369423; ENSP00000358431; ENSG00000124334 [Q01113-3]
GeneIDi3581
KEGGihsa:3581
UCSCiuc004fnu.2 human [Q01113-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiIL9R_HUMAN
AccessioniPrimary (citable) accession number: Q01113
Secondary accession number(s): B9ZVT0
, Q14634, Q8WWU1, Q96TF0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: July 18, 2018
This is version 179 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health