Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin-binding protein C, slow-type

Gene

MYBPC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.

GO - Molecular functioni

  • actin filament binding Source: GO_Central
  • muscle alpha-actinin binding Source: GO_Central
  • structural constituent of muscle Source: GO_Central
  • titin binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionActin-binding, Muscle protein
Biological processCell adhesion

Enzyme and pathway databases

ReactomeiR-HSA-390522 Striated Muscle Contraction

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin-binding protein C, slow-type
Short name:
Slow MyBP-C
Alternative name(s):
C-protein, skeletal muscle slow isoform
Gene namesi
Name:MYBPC1
Synonyms:MYBPCS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000196091.12
HGNCiHGNC:7549 MYBPC1
MIMi160794 gene
neXtProtiNX_Q00872

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Thick filament

Pathology & Biotechi

Involvement in diseasei

Arthrogryposis, distal, 1B (DA1B)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of distal arthrogryposis, a disease characterized by congenital joint contractures that mainly involve two or more distal parts of the limbs, in the absence of a primary neurological or muscle disease. Distal arthrogryposis type 1 is characterized largely by camptodactyly and clubfoot. Hypoplasia and/or absence of some interphalangeal creases is common. The shoulders and hips are less frequently affected.
See also OMIM:614335
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075219161E → K in DA1B; may affect splicing. 1 Publication1
Natural variantiVAR_067045211W → R in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906657Ensembl.1
Natural variantiVAR_067046849Y → H in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906658Ensembl.1
Lethal congenital contracture syndrome 4 (LCCS4)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of lethal congenital contracture syndrome, an autosomal recessive disorder characterized by degeneration of anterior horn neurons, extreme skeletal muscle atrophy and congenital non-progressive joint contractures. The contractures can involve the upper or lower limbs and/or the vertebral column, leading to various degrees of flexion or extension limitations evident at birth.
See also OMIM:614915

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi4604
MalaCardsiMYBPC1
MIMi614335 phenotype
614915 phenotype
OpenTargetsiENSG00000196091
Orphaneti1146 Digitotalar dysmorphism
137783 Lethal congenital contracture syndrome type 3
498693 MYBPC1-related autosomal recessive non-lethal arthrogryposis multiplex congenita syndrome
PharmGKBiPA31349

Polymorphism and mutation databases

BioMutaiMYBPC1
DMDMi6166597

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000726891 – 1141Myosin-binding protein C, slow-typeAdd BLAST1141

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei406PhosphothreonineBy similarity1
Modified residuei611PhosphoserineBy similarity1
Modified residuei798PhosphothreonineBy similarity1
Modified residuei823PhosphotyrosineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ00872
PeptideAtlasiQ00872
PRIDEiQ00872
ProteomicsDBi57876
57877 [Q00872-2]
57878 [Q00872-3]

PTM databases

iPTMnetiQ00872
PhosphoSitePlusiQ00872

Expressioni

Gene expression databases

BgeeiENSG00000196091 Expressed in 169 organ(s), highest expression level in skeletal muscle tissue of rectus abdominis
CleanExiHS_MYBPC1
ExpressionAtlasiQ00872 baseline and differential
GenevisibleiQ00872 HS

Organism-specific databases

HPAiHPA021004
HPA027614

Interactioni

Subunit structurei

Interacts with USP25 (isoform USP25m only); the interaction prevents proteasomal degradation of MYBPC1.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110689, 11 interactors
IntActiQ00872, 16 interactors
STRINGi9606.ENSP00000354849

Structurei

Secondary structure

11141
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ00872
SMRiQ00872
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ00872

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini72 – 144Ig-like C2-type 1Add BLAST73
Domaini251 – 340Ig-like C2-type 2Add BLAST90
Domaini341 – 431Ig-like C2-type 3Add BLAST91
Domaini432 – 520Ig-like C2-type 4Add BLAST89
Domaini522 – 619Ig-like C2-type 5Add BLAST98
Domaini622 – 721Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST100
Domaini722 – 833Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST112
Domaini837 – 931Ig-like C2-type 6Add BLAST95
Domaini934 – 1029Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini1047 – 1141Ig-like C2-type 7Add BLAST95

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. MyBP family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiENOG410IFCI Eukaryota
ENOG4110AYI LUCA
GeneTreeiENSGT00860000133685
HOGENOMiHOG000220906
HOVERGENiHBG052560
InParanoidiQ00872
KOiK12557
OMAiTAEYSVM
OrthoDBiEOG091G00ND
PhylomeDBiQ00872
TreeFamiTF351819

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 10 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 7 hits
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 7 hits
SM00408 IGc2, 4 hits
SUPFAMiSSF48726 SSF48726, 7 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 4 hits

Sequences (10+)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q00872-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPEPTKKEEN EVPAPAPPPE EPSKEKEAGT TPAKDWTLVE TPPGEEQAKQ
60 70 80 90 100
NANSQLSILF IEKPQGGTVK VGEDITFIAK VKAEDLLRKP TIKWFKGKWM
110 120 130 140 150
DLASKAGKHL QLKETFERHS RVYTFEMQII KAKDNFAGNY RCEVTYKDKF
160 170 180 190 200
DSCSFDLEVH ESTGTTPNID IRSAFKRSGE GQEDAGELDF SGLLKRREVK
210 220 230 240 250
QQEEEPQVDV WELLKNAKPS EYEKIAFQYG ITDLRGMLKR LKRMRREEKK
260 270 280 290 300
SAAFAKILDP AYQVDKGGRV RFVVELADPK LEVKWYKNGQ EIRPSTKYIF
310 320 330 340 350
EHKGCQRILF INNCQMTDDS EYYVTAGDEK CSTELFVREP PIMVTKQLED
360 370 380 390 400
TTAYCGERVE LECEVSEDDA NVKWFKNGEE IIPGPKSRYR IRVEGKKHIL
410 420 430 440 450
IIEGATKADA AEYSVMTTGG QSSAKLSVDL KPLKILTPLT DQTVNLGKEI
460 470 480 490 500
CLKCEISENI PGKWTKNGLP VQESDRLKVV HKGRIHKLVI ANALTEDEGD
510 520 530 540 550
YVFAPDAYNV TLPAKVHVID PPKIILDGLD ADNTVTVIAG NKLRLEIPIS
560 570 580 590 600
GEPPPKAMWS RGDKAIMEGS GRIRTESYPD SSTLVIDIAE RDDSGVYHIN
610 620 630 640 650
LKNEAGEAHA SIKVKVVDFP DPPVAPTVTE VGDDWCIMNW EPPAYDGGSP
660 670 680 690 700
ILGYFIERKK KQSSRWMRLN FDLCKETTFE PKKMIEGVAY EVRIFAVNAI
710 720 730 740 750
GISKPSMPSR PFVPLAVTSP PTLLTVDSVT DTTVTMRWRP PDHIGAAGLD
760 770 780 790 800
GYVLEYCFEG STSAKQSDEN GEAAYDLPAE DWIVANKDLI DKTKFTITGL
810 820 830 840 850
PTDAKIFVRV KAVNAAGASE PKYYSQPILV KEIIEPPKIR IPRHLKQTYI
860 870 880 890 900
RRVGEAVNLV IPFQGKPRPE LTWKKDGAEI DKNQINIRNS ETDTIIFIRK
910 920 930 940 950
AERSHSGKYD LQVKVDKFVE TASIDIQIID RPGPPQIVKI EDVWGENVAL
960 970 980 990 1000
TWTPPKDDGN AAITGYTIQK ADKKSMEWFT VIEHYHRTSA TITELVIGNE
1010 1020 1030 1040 1050
YYFRVFSENM CGLSEDATMT KESAVIARDG KIYKNPVYED FDFSEAPMFT
1060 1070 1080 1090 1100
QPLVNTYAIA GYNATLNCSV RGNPKPKITW MKNKVAIVDD PRYRMFSNQG
1110 1120 1130 1140
VCTLEIRKPS PYDGGTYCCK AVNDLGTVEI ECKLEVKVIA Q
Length:1,141
Mass (Da):128,294
Last modified:July 15, 1999 - v2
Checksum:i8B3A91422CA9F2B2
GO
Isoform 2 (identifier: Q00872-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: K → KDEEEVSPPSALPPGLGSRALERKDS
     761-779: STSAKQSDENGEAAYDLPA → T

Show »
Length:1,148
Mass (Da):129,078
Checksum:i72727E7835F0D40B
GO
Isoform 3 (identifier: Q00872-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     761-779: STSAKQSDENGEAAYDLPA → T

Show »
Length:1,123
Mass (Da):126,460
Checksum:i591BA0B178FBC34E
GO
Isoform 4 (identifier: Q00872-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: K → KDEEEVSPPSALPPGLGSRALERKDS
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Note: No experimental confirmation available.
Show »
Length:1,171
Mass (Da):131,693
Checksum:iAC9045F326327888
GO
Isoform 5 (identifier: Q00872-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-34: Missing.
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,120
Mass (Da):126,391
Checksum:i575567B5667B51F4
GO
Isoform 6 (identifier: Q00872-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQVGSPSADSSCKAYLQT

Show »
Length:1,173
Mass (Da):131,663
Checksum:iCD8FE610739C3673
GO
Isoform 7 (identifier: Q00872-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-34: ENEVPAPAPPPEEPSKEKEAGTTPAK → DEEEVSPPSALPP
     761-779: STSAKQSDENGEAAYDLPA → T
     1138-1141: VIAQ → GGLSFCRLLLQGVPPNIIDSYLRDLHSSNPEEY

Show »
Length:1,139
Mass (Da):128,400
Checksum:iE38F27C8493D4E99
GO
Isoform 8 (identifier: Q00872-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     8-19: Missing.
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,134
Mass (Da):127,846
Checksum:iA82E89555116CCC9
GO
Isoform 9 (identifier: Q00872-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-194: Missing.
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,127
Mass (Da):127,084
Checksum:i191098988F4AB122
GO
Isoform 10 (identifier: Q00872-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,146
Mass (Da):129,074
Checksum:i73BEF2496BACAF93
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VZY0F8VZY0_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
1,154Annotation score:
F8VZE0F8VZE0_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
1,132Annotation score:
G3V1V7G3V1V7_HUMAN
Myosin binding protein C, slow type...
MYBPC1 hCG_21838
1,024Annotation score:
F8W1Z9F8W1Z9_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
104Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti87 – 88LR → SE in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti93 – 97KWFKG → NGSR in CAA46987 (PubMed:1429890).Curated5
Sequence conflicti146Y → H in BAG59277 (PubMed:14702039).Curated1
Sequence conflicti217A → T in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti230 – 235GITDLR → ESPTCS in CAA46987 (PubMed:1429890).Curated6
Sequence conflicti244 – 245MR → SI in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti261A → V in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti286Y → N in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti292I → L in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti302 – 312HKGCQRILFIN → DTRCQSILNID in CAA46987 (PubMed:1429890).CuratedAdd BLAST11
Sequence conflicti336F → L in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti353A → D in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti371N → Q in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti383 – 387PGPKS → LVQT in CAA46987 (PubMed:1429890).Curated5
Sequence conflicti412E → D in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti421Q → L in CAD91144 (PubMed:17974005).Curated1
Sequence conflicti491 – 492AN → DH in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti752Y → C in CAD89907 (PubMed:17974005).Curated1
Sequence conflicti752Y → H in CAD38925 (PubMed:17974005).Curated1
Sequence conflicti840 – 843RIPR → HSPK in CAA46987 (PubMed:1429890).Curated4
Sequence conflicti855 – 858EAVN → DRVI in CAA46987 (PubMed:1429890).Curated4
Sequence conflicti925D → G in BAH13954 (PubMed:14702039).Curated1
Sequence conflicti927Q → R in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti946E → R in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti979 – 980FT → LR in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti985 – 992YHRTSATI → IIEPVPH in CAA46987 (PubMed:1429890).Curated8
Sequence conflicti1056 – 1063TYAIAGYN → RLCHSGYM in CAA46987 (PubMed:1429890).Curated8
Sequence conflicti1099Q → L in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti1107R → G in CAA46987 (PubMed:1429890).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075219161E → K in DA1B; may affect splicing. 1 Publication1
Natural variantiVAR_067045211W → R in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906657Ensembl.1
Natural variantiVAR_021923481H → Q. Corresponds to variant dbSNP:rs3817552Ensembl.1
Natural variantiVAR_067046849Y → H in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906658Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0467358 – 19Missing in isoform 8. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_0467369 – 34Missing in isoform 5. 2 PublicationsAdd BLAST26
Alternative sequenceiVSP_0467379 – 34ENEVP…TTPAK → DEEEVSPPSALPP in isoform 7. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_03910534K → KDEEEVSPPSALPPGLGSRA LERKDS in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_046738176 – 194Missing in isoform 9. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_039106761 – 779STSAK…YDLPA → T in isoform 2, isoform 3, isoform 4, isoform 5, isoform 7, isoform 8, isoform 9 and isoform 10. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_0467391138 – 1141VIAQ → GGLSFCRLLLQGVPPNIIDS YLRDLHSSNPEEY in isoform 7. 1 Publication4
Alternative sequenceiVSP_0452411140 – 1141AQ → YQGVNTPGQPVFLEGQQQSL HNKDF in isoform 4, isoform 5, isoform 8, isoform 9 and isoform 10. 3 Publications2
Alternative sequenceiVSP_0467401140 – 1141AQ → YQGVNTPGQPVFLEGQQQVG SPSADSSCKAYLQT in isoform 6. 2 Publications2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X66276 mRNA Translation: CAA46987.1
X73114 mRNA Translation: CAA51545.1
AK295727 mRNA Translation: BAG58568.1
AK296681 mRNA Translation: BAG59277.1
AK303401 mRNA Translation: BAH13954.1
AL831993 mRNA Translation: CAD89907.1
AL832000 mRNA Translation: CAD91144.1
AL834249 mRNA Translation: CAD38925.1
AC010205 Genomic DNA No translation available.
AC090671 Genomic DNA No translation available.
AC117505 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97665.1
CH471054 Genomic DNA Translation: EAW97669.1
CH471054 Genomic DNA Translation: EAW97672.1
BC092418 mRNA Translation: AAH92418.1
BC117217 mRNA Translation: AAI17218.1
BC143495 mRNA Translation: AAI43496.1
BC143502 mRNA Translation: AAI43503.1
BC143503 mRNA Translation: AAI43504.1
BC143504 mRNA Translation: AAI43505.1
CCDSiCCDS55877.1 [Q00872-3]
CCDS58268.1 [Q00872-6]
CCDS58269.1 [Q00872-10]
CCDS58270.1 [Q00872-9]
CCDS58271.1 [Q00872-8]
CCDS58272.1 [Q00872-7]
CCDS58273.1 [Q00872-5]
CCDS9083.1 [Q00872-4]
CCDS9084.1 [Q00872-2]
CCDS9085.1 [Q00872-1]
PIRiS24614
S36846
RefSeqiNP_001241647.1, NM_001254718.1 [Q00872-6]
NP_001241648.1, NM_001254719.1 [Q00872-10]
NP_001241649.1, NM_001254720.1 [Q00872-8]
NP_001241650.1, NM_001254721.1 [Q00872-9]
NP_001241651.1, NM_001254722.1 [Q00872-5]
NP_001241652.1, NM_001254723.1 [Q00872-7]
NP_002456.2, NM_002465.3 [Q00872-4]
NP_996555.1, NM_206819.2 [Q00872-2]
NP_996556.1, NM_206820.2 [Q00872-1]
NP_996557.1, NM_206821.2 [Q00872-3]
UniGeneiHs.654589

Genome annotation databases

EnsembliENST00000361466; ENSP00000354849; ENSG00000196091 [Q00872-4]
ENST00000361685; ENSP00000354845; ENSG00000196091 [Q00872-2]
ENST00000392934; ENSP00000376665; ENSG00000196091 [Q00872-7]
ENST00000452455; ENSP00000400908; ENSG00000196091 [Q00872-6]
ENST00000536007; ENSP00000446128; ENSG00000196091 [Q00872-9]
ENST00000541119; ENSP00000442847; ENSG00000196091 [Q00872-8]
ENST00000545503; ENSP00000440034; ENSG00000196091 [Q00872-10]
ENST00000547405; ENSP00000448175; ENSG00000196091 [Q00872-5]
ENST00000550270; ENSP00000449702; ENSG00000196091 [Q00872-1]
ENST00000553190; ENSP00000447900; ENSG00000196091 [Q00872-3]
GeneIDi4604
KEGGihsa:4604
UCSCiuc001tig.4 human [Q00872-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X66276 mRNA Translation: CAA46987.1
X73114 mRNA Translation: CAA51545.1
AK295727 mRNA Translation: BAG58568.1
AK296681 mRNA Translation: BAG59277.1
AK303401 mRNA Translation: BAH13954.1
AL831993 mRNA Translation: CAD89907.1
AL832000 mRNA Translation: CAD91144.1
AL834249 mRNA Translation: CAD38925.1
AC010205 Genomic DNA No translation available.
AC090671 Genomic DNA No translation available.
AC117505 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97665.1
CH471054 Genomic DNA Translation: EAW97669.1
CH471054 Genomic DNA Translation: EAW97672.1
BC092418 mRNA Translation: AAH92418.1
BC117217 mRNA Translation: AAI17218.1
BC143495 mRNA Translation: AAI43496.1
BC143502 mRNA Translation: AAI43503.1
BC143503 mRNA Translation: AAI43504.1
BC143504 mRNA Translation: AAI43505.1
CCDSiCCDS55877.1 [Q00872-3]
CCDS58268.1 [Q00872-6]
CCDS58269.1 [Q00872-10]
CCDS58270.1 [Q00872-9]
CCDS58271.1 [Q00872-8]
CCDS58272.1 [Q00872-7]
CCDS58273.1 [Q00872-5]
CCDS9083.1 [Q00872-4]
CCDS9084.1 [Q00872-2]
CCDS9085.1 [Q00872-1]
PIRiS24614
S36846
RefSeqiNP_001241647.1, NM_001254718.1 [Q00872-6]
NP_001241648.1, NM_001254719.1 [Q00872-10]
NP_001241649.1, NM_001254720.1 [Q00872-8]
NP_001241650.1, NM_001254721.1 [Q00872-9]
NP_001241651.1, NM_001254722.1 [Q00872-5]
NP_001241652.1, NM_001254723.1 [Q00872-7]
NP_002456.2, NM_002465.3 [Q00872-4]
NP_996555.1, NM_206819.2 [Q00872-2]
NP_996556.1, NM_206820.2 [Q00872-1]
NP_996557.1, NM_206821.2 [Q00872-3]
UniGeneiHs.654589

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X44NMR-A342-431[»]
2DAVNMR-A58-170[»]
2YUVNMR-A252-338[»]
2YUWNMR-A718-832[»]
2YUXNMR-A922-1034[»]
2YUZNMR-A433-519[»]
2YXMX-ray1.51A252-338[»]
ProteinModelPortaliQ00872
SMRiQ00872
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110689, 11 interactors
IntActiQ00872, 16 interactors
STRINGi9606.ENSP00000354849

PTM databases

iPTMnetiQ00872
PhosphoSitePlusiQ00872

Polymorphism and mutation databases

BioMutaiMYBPC1
DMDMi6166597

Proteomic databases

PaxDbiQ00872
PeptideAtlasiQ00872
PRIDEiQ00872
ProteomicsDBi57876
57877 [Q00872-2]
57878 [Q00872-3]

Protocols and materials databases

DNASUi4604
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361466; ENSP00000354849; ENSG00000196091 [Q00872-4]
ENST00000361685; ENSP00000354845; ENSG00000196091 [Q00872-2]
ENST00000392934; ENSP00000376665; ENSG00000196091 [Q00872-7]
ENST00000452455; ENSP00000400908; ENSG00000196091 [Q00872-6]
ENST00000536007; ENSP00000446128; ENSG00000196091 [Q00872-9]
ENST00000541119; ENSP00000442847; ENSG00000196091 [Q00872-8]
ENST00000545503; ENSP00000440034; ENSG00000196091 [Q00872-10]
ENST00000547405; ENSP00000448175; ENSG00000196091 [Q00872-5]
ENST00000550270; ENSP00000449702; ENSG00000196091 [Q00872-1]
ENST00000553190; ENSP00000447900; ENSG00000196091 [Q00872-3]
GeneIDi4604
KEGGihsa:4604
UCSCiuc001tig.4 human [Q00872-1]

Organism-specific databases

CTDi4604
DisGeNETi4604
EuPathDBiHostDB:ENSG00000196091.12
GeneCardsiMYBPC1
HGNCiHGNC:7549 MYBPC1
HPAiHPA021004
HPA027614
MalaCardsiMYBPC1
MIMi160794 gene
614335 phenotype
614915 phenotype
neXtProtiNX_Q00872
OpenTargetsiENSG00000196091
Orphaneti1146 Digitotalar dysmorphism
137783 Lethal congenital contracture syndrome type 3
498693 MYBPC1-related autosomal recessive non-lethal arthrogryposis multiplex congenita syndrome
PharmGKBiPA31349
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFCI Eukaryota
ENOG4110AYI LUCA
GeneTreeiENSGT00860000133685
HOGENOMiHOG000220906
HOVERGENiHBG052560
InParanoidiQ00872
KOiK12557
OMAiTAEYSVM
OrthoDBiEOG091G00ND
PhylomeDBiQ00872
TreeFamiTF351819

Enzyme and pathway databases

ReactomeiR-HSA-390522 Striated Muscle Contraction

Miscellaneous databases

ChiTaRSiMYBPC1 human
EvolutionaryTraceiQ00872
GeneWikiiMYBPC1
GenomeRNAii4604
PROiPR:Q00872
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196091 Expressed in 169 organ(s), highest expression level in skeletal muscle tissue of rectus abdominis
CleanExiHS_MYBPC1
ExpressionAtlasiQ00872 baseline and differential
GenevisibleiQ00872 HS

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 10 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 7 hits
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 7 hits
SM00408 IGc2, 4 hits
SUPFAMiSSF48726 SSF48726, 7 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiMYPC1_HUMAN
AccessioniPrimary (citable) accession number: Q00872
Secondary accession number(s): B4DKR5
, B7Z8G8, B7ZL02, B7ZL09, B7ZL10, E7ESM5, E7EWS6, G3XAE8, Q15497, Q17RR7, Q569K7, Q86T48, Q86TC8, Q8N3L2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 15, 1999
Last modified: November 7, 2018
This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again