Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 179 (17 Jun 2020)
Sequence version 2 (15 Jul 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Myosin-binding protein C, slow-type

Gene

MYBPC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. Slow skeletal protein that binds to both myosin and actin (PubMed:31264822, PubMed:31025394). In vitro, binds to native thin filaments and modifies the activity of actin-activated myosin ATPase. May modulate muscle contraction or may play a more structural role.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: UniProtKB-KW
  • structural constituent of muscle Source: ProtInc
  • titin binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Muscle protein
Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-390522 Striated Muscle Contraction

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myosin-binding protein C, slow-type
Short name:
Slow MyBP-C
Alternative name(s):
C-protein, skeletal muscle slow isoform
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYBPC1
Synonyms:MYBPCS
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196091.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7549 MYBPC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
160794 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q00872

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Thick filament

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Arthrogryposis, distal, 1B (DA1B)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of distal arthrogryposis, a disease characterized by congenital joint contractures that mainly involve two or more distal parts of the limbs, in the absence of a primary neurological or muscle disease. Distal arthrogryposis type 1 is characterized largely by camptodactyly and clubfoot. Hypoplasia and/or absence of some interphalangeal creases is common. The shoulders and hips are less frequently affected.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_075219161E → K in DA1B; may affect splicing. 1 PublicationCorresponds to variant dbSNP:rs1370563966Ensembl.1
Natural variantiVAR_067045211W → R in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906657Ensembl.1
Natural variantiVAR_067046849Y → H in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906658Ensembl.1
Lethal congenital contracture syndrome 4 (LCCS4)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of lethal congenital contracture syndrome, an autosomal recessive disorder characterized by degeneration of anterior horn neurons, extreme skeletal muscle atrophy and congenital non-progressive joint contractures. The contractures can involve the upper or lower limbs and/or the vertebral column, leading to various degrees of flexion or extension limitations evident at birth.
Related information in OMIM
Myopathy, congenital, with tremor (MYOTREM)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant muscular disorder characterized by muscle weakness, hypotonia associated with high-frequency postural tremor of the limbs, mildly delayed walking, and steppage gait. Additional features include skeletal deformities such as scoliosis, thoracic asymmetry and spinal rigidity. Some patients show mild facial dysmorphic features. Cognitive functions are normal.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_083207222Y → H in MYOTREM; changes in electrostatic interactions resulting in increased myosin binding; no effect on actin binding. 1 Publication1
Natural variantiVAR_083208223E → K in MYOTREM; changes in electrostatic interactions resulting in increased myosin binding; no effect on actin binding. 1 Publication1
Natural variantiVAR_083209234L → P in MYOTREM; no effects on myosin or actin binding; reduced helicity of certain domains. 1 Publication1
Natural variantiVAR_083210238L → R in MYOTREM; decreased binding to myosin; no effect on actin binding. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
4604

MalaCards human disease database

More...
MalaCardsi
MYBPC1
MIMi614335 phenotype
614915 phenotype
618524 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000196091

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
1146 Digitotalar dysmorphism
137783 Lethal congenital contracture syndrome type 3
498693 MYBPC1-related autosomal recessive non-lethal arthrogryposis multiplex congenita syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31349

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q00872 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MYBPC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
6166597

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000726891 – 1141Myosin-binding protein C, slow-typeAdd BLAST1141

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei406PhosphothreonineBy similarity1
Modified residuei611PhosphoserineBy similarity1
Modified residuei798PhosphothreonineBy similarity1
Modified residuei823PhosphotyrosineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q00872

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q00872

PeptideAtlas

More...
PeptideAtlasi
Q00872

PRoteomics IDEntifications database

More...
PRIDEi
Q00872

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
18023
18903
33729
57876 [Q00872-1]
57877 [Q00872-2]
57878 [Q00872-3]
61165
7205
7206
7207

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q00872

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q00872

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196091 Expressed in skeletal muscle tissue of rectus abdominis and 168 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q00872 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q00872 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000196091 Tissue enriched (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with USP25 (isoform USP25m only); the interaction prevents proteasomal degradation of MYBPC1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
110689, 12 interactors

Protein interaction database and analysis system

More...
IntActi
Q00872, 19 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000400908

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q00872 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11141
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q00872

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q00872

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini72 – 144Ig-like C2-type 1Add BLAST73
Domaini251 – 340Ig-like C2-type 2Add BLAST90
Domaini341 – 431Ig-like C2-type 3Add BLAST91
Domaini432 – 520Ig-like C2-type 4Add BLAST89
Domaini522 – 619Ig-like C2-type 5Add BLAST98
Domaini622 – 721Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST100
Domaini722 – 833Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST112
Domaini837 – 931Ig-like C2-type 6Add BLAST95
Domaini934 – 1029Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini1047 – 1141Ig-like C2-type 7Add BLAST95

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. MyBP family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFCI Eukaryota
ENOG4110AYI LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158254

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q00872

KEGG Orthology (KO)

More...
KOi
K12557

Identification of Orthologs from Complete Genome Data

More...
OMAi
CFEGTDE

Database of Orthologous Groups

More...
OrthoDBi
67092at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q00872

TreeFam database of animal gene trees

More...
TreeFami
TF351819

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 10 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040849 MyBP-C_THB

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 7 hits
PF18362 THB, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 7 hits
SM00408 IGc2, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 7 hits
SSF49265 SSF49265, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q00872-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPEPTKKEEN EVPAPAPPPE EPSKEKEAGT TPAKDWTLVE TPPGEEQAKQ
60 70 80 90 100
NANSQLSILF IEKPQGGTVK VGEDITFIAK VKAEDLLRKP TIKWFKGKWM
110 120 130 140 150
DLASKAGKHL QLKETFERHS RVYTFEMQII KAKDNFAGNY RCEVTYKDKF
160 170 180 190 200
DSCSFDLEVH ESTGTTPNID IRSAFKRSGE GQEDAGELDF SGLLKRREVK
210 220 230 240 250
QQEEEPQVDV WELLKNAKPS EYEKIAFQYG ITDLRGMLKR LKRMRREEKK
260 270 280 290 300
SAAFAKILDP AYQVDKGGRV RFVVELADPK LEVKWYKNGQ EIRPSTKYIF
310 320 330 340 350
EHKGCQRILF INNCQMTDDS EYYVTAGDEK CSTELFVREP PIMVTKQLED
360 370 380 390 400
TTAYCGERVE LECEVSEDDA NVKWFKNGEE IIPGPKSRYR IRVEGKKHIL
410 420 430 440 450
IIEGATKADA AEYSVMTTGG QSSAKLSVDL KPLKILTPLT DQTVNLGKEI
460 470 480 490 500
CLKCEISENI PGKWTKNGLP VQESDRLKVV HKGRIHKLVI ANALTEDEGD
510 520 530 540 550
YVFAPDAYNV TLPAKVHVID PPKIILDGLD ADNTVTVIAG NKLRLEIPIS
560 570 580 590 600
GEPPPKAMWS RGDKAIMEGS GRIRTESYPD SSTLVIDIAE RDDSGVYHIN
610 620 630 640 650
LKNEAGEAHA SIKVKVVDFP DPPVAPTVTE VGDDWCIMNW EPPAYDGGSP
660 670 680 690 700
ILGYFIERKK KQSSRWMRLN FDLCKETTFE PKKMIEGVAY EVRIFAVNAI
710 720 730 740 750
GISKPSMPSR PFVPLAVTSP PTLLTVDSVT DTTVTMRWRP PDHIGAAGLD
760 770 780 790 800
GYVLEYCFEG STSAKQSDEN GEAAYDLPAE DWIVANKDLI DKTKFTITGL
810 820 830 840 850
PTDAKIFVRV KAVNAAGASE PKYYSQPILV KEIIEPPKIR IPRHLKQTYI
860 870 880 890 900
RRVGEAVNLV IPFQGKPRPE LTWKKDGAEI DKNQINIRNS ETDTIIFIRK
910 920 930 940 950
AERSHSGKYD LQVKVDKFVE TASIDIQIID RPGPPQIVKI EDVWGENVAL
960 970 980 990 1000
TWTPPKDDGN AAITGYTIQK ADKKSMEWFT VIEHYHRTSA TITELVIGNE
1010 1020 1030 1040 1050
YYFRVFSENM CGLSEDATMT KESAVIARDG KIYKNPVYED FDFSEAPMFT
1060 1070 1080 1090 1100
QPLVNTYAIA GYNATLNCSV RGNPKPKITW MKNKVAIVDD PRYRMFSNQG
1110 1120 1130 1140
VCTLEIRKPS PYDGGTYCCK AVNDLGTVEI ECKLEVKVIA Q
Length:1,141
Mass (Da):128,294
Last modified:July 15, 1999 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8B3A91422CA9F2B2
GO
Isoform 2 (identifier: Q00872-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: K → KDEEEVSPPSALPPGLGSRALERKDS
     761-779: STSAKQSDENGEAAYDLPA → T

Show »
Length:1,148
Mass (Da):129,078
Checksum:i72727E7835F0D40B
GO
Isoform 3 (identifier: Q00872-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     761-779: STSAKQSDENGEAAYDLPA → T

Show »
Length:1,123
Mass (Da):126,460
Checksum:i591BA0B178FBC34E
GO
Isoform 4 (identifier: Q00872-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: K → KDEEEVSPPSALPPGLGSRALERKDS
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,171
Mass (Da):131,693
Checksum:iAC9045F326327888
GO
Isoform 5 (identifier: Q00872-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-34: Missing.
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,120
Mass (Da):126,391
Checksum:i575567B5667B51F4
GO
Isoform 6 (identifier: Q00872-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQVGSPSADSSCKAYLQT

Show »
Length:1,173
Mass (Da):131,663
Checksum:iCD8FE610739C3673
GO
Isoform 7 (identifier: Q00872-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-34: ENEVPAPAPPPEEPSKEKEAGTTPAK → DEEEVSPPSALPP
     761-779: STSAKQSDENGEAAYDLPA → T
     1138-1141: VIAQ → GGLSFCRLLLQGVPPNIIDSYLRDLHSSNPEEY

Show »
Length:1,139
Mass (Da):128,400
Checksum:iE38F27C8493D4E99
GO
Isoform 8 (identifier: Q00872-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     8-19: Missing.
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,134
Mass (Da):127,846
Checksum:iA82E89555116CCC9
GO
Isoform 9 (identifier: Q00872-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-194: Missing.
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,127
Mass (Da):127,084
Checksum:i191098988F4AB122
GO
Isoform 10 (identifier: Q00872-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     761-779: STSAKQSDENGEAAYDLPA → T
     1140-1141: AQ → YQGVNTPGQPVFLEGQQQSLHNKDF

Show »
Length:1,146
Mass (Da):129,074
Checksum:i73BEF2496BACAF93
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VZY0F8VZY0_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
1,154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZE0F8VZE0_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
1,132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1Z9F8W1Z9_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V1V7G3V1V7_HUMAN
Myosin binding protein C, slow type...
MYBPC1 hCG_21838
1,024Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A669KAR9A0A669KAR9_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
23Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A669KB32A0A669KB32_HUMAN
Myosin-binding protein C, slow-type
MYBPC1
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti87 – 88LR → SE in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti93 – 97KWFKG → NGSR in CAA46987 (PubMed:1429890).Curated5
Sequence conflicti146Y → H in BAG59277 (PubMed:14702039).Curated1
Sequence conflicti217A → T in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti230 – 235GITDLR → ESPTCS in CAA46987 (PubMed:1429890).Curated6
Sequence conflicti244 – 245MR → SI in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti261A → V in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti286Y → N in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti292I → L in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti302 – 312HKGCQRILFIN → DTRCQSILNID in CAA46987 (PubMed:1429890).CuratedAdd BLAST11
Sequence conflicti336F → L in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti353A → D in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti371N → Q in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti383 – 387PGPKS → LVQT in CAA46987 (PubMed:1429890).Curated5
Sequence conflicti412E → D in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti421Q → L in CAD91144 (PubMed:17974005).Curated1
Sequence conflicti491 – 492AN → DH in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti752Y → C in CAD89907 (PubMed:17974005).Curated1
Sequence conflicti752Y → H in CAD38925 (PubMed:17974005).Curated1
Sequence conflicti840 – 843RIPR → HSPK in CAA46987 (PubMed:1429890).Curated4
Sequence conflicti855 – 858EAVN → DRVI in CAA46987 (PubMed:1429890).Curated4
Sequence conflicti925D → G in BAH13954 (PubMed:14702039).Curated1
Sequence conflicti927Q → R in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti946E → R in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti979 – 980FT → LR in CAA46987 (PubMed:1429890).Curated2
Sequence conflicti985 – 992YHRTSATI → IIEPVPH in CAA46987 (PubMed:1429890).Curated8
Sequence conflicti1056 – 1063TYAIAGYN → RLCHSGYM in CAA46987 (PubMed:1429890).Curated8
Sequence conflicti1099Q → L in CAA46987 (PubMed:1429890).Curated1
Sequence conflicti1107R → G in CAA46987 (PubMed:1429890).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075219161E → K in DA1B; may affect splicing. 1 PublicationCorresponds to variant dbSNP:rs1370563966Ensembl.1
Natural variantiVAR_067045211W → R in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906657Ensembl.1
Natural variantiVAR_083207222Y → H in MYOTREM; changes in electrostatic interactions resulting in increased myosin binding; no effect on actin binding. 1 Publication1
Natural variantiVAR_083208223E → K in MYOTREM; changes in electrostatic interactions resulting in increased myosin binding; no effect on actin binding. 1 Publication1
Natural variantiVAR_083209234L → P in MYOTREM; no effects on myosin or actin binding; reduced helicity of certain domains. 1 Publication1
Natural variantiVAR_083210238L → R in MYOTREM; decreased binding to myosin; no effect on actin binding. 1 Publication1
Natural variantiVAR_021923481H → Q. Corresponds to variant dbSNP:rs3817552Ensembl.1
Natural variantiVAR_067046849Y → H in DA1B. 1 PublicationCorresponds to variant dbSNP:rs387906658Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0467358 – 19Missing in isoform 8. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_0467369 – 34Missing in isoform 5. 2 PublicationsAdd BLAST26
Alternative sequenceiVSP_0467379 – 34ENEVP…TTPAK → DEEEVSPPSALPP in isoform 7. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_03910534K → KDEEEVSPPSALPPGLGSRA LERKDS in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_046738176 – 194Missing in isoform 9. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_039106761 – 779STSAK…YDLPA → T in isoform 2, isoform 3, isoform 4, isoform 5, isoform 7, isoform 8, isoform 9 and isoform 10. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_0467391138 – 1141VIAQ → GGLSFCRLLLQGVPPNIIDS YLRDLHSSNPEEY in isoform 7. 1 Publication4
Alternative sequenceiVSP_0452411140 – 1141AQ → YQGVNTPGQPVFLEGQQQSL HNKDF in isoform 4, isoform 5, isoform 8, isoform 9 and isoform 10. 3 Publications2
Alternative sequenceiVSP_0467401140 – 1141AQ → YQGVNTPGQPVFLEGQQQVG SPSADSSCKAYLQT in isoform 6. 2 Publications2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X66276 mRNA Translation: CAA46987.1
X73114 mRNA Translation: CAA51545.1
AK295727 mRNA Translation: BAG58568.1
AK296681 mRNA Translation: BAG59277.1
AK303401 mRNA Translation: BAH13954.1
AL831993 mRNA Translation: CAD89907.1
AL832000 mRNA Translation: CAD91144.1
AL834249 mRNA Translation: CAD38925.1
AC010205 Genomic DNA No translation available.
AC090671 Genomic DNA No translation available.
AC117505 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97665.1
CH471054 Genomic DNA Translation: EAW97669.1
CH471054 Genomic DNA Translation: EAW97672.1
BC092418 mRNA Translation: AAH92418.1
BC117217 mRNA Translation: AAI17218.1
BC143495 mRNA Translation: AAI43496.1
BC143502 mRNA Translation: AAI43503.1
BC143503 mRNA Translation: AAI43504.1
BC143504 mRNA Translation: AAI43505.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55877.1 [Q00872-3]
CCDS58268.1 [Q00872-6]
CCDS58269.1 [Q00872-10]
CCDS58270.1 [Q00872-9]
CCDS58271.1 [Q00872-8]
CCDS58272.1 [Q00872-7]
CCDS58273.1 [Q00872-5]
CCDS9083.1 [Q00872-4]
CCDS9084.1 [Q00872-2]
CCDS9085.1 [Q00872-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S24614
S36846

NCBI Reference Sequences

More...
RefSeqi
NP_001241647.1, NM_001254718.1 [Q00872-6]
NP_001241648.1, NM_001254719.1 [Q00872-10]
NP_001241649.1, NM_001254720.1 [Q00872-8]
NP_001241650.1, NM_001254721.1 [Q00872-9]
NP_001241651.1, NM_001254722.1 [Q00872-5]
NP_001241652.1, NM_001254723.1 [Q00872-7]
NP_002456.2, NM_002465.3 [Q00872-4]
NP_996555.1, NM_206819.2 [Q00872-2]
NP_996556.1, NM_206820.2 [Q00872-1]
NP_996557.1, NM_206821.2 [Q00872-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361466; ENSP00000354849; ENSG00000196091 [Q00872-4]
ENST00000361685; ENSP00000354845; ENSG00000196091 [Q00872-2]
ENST00000392934; ENSP00000376665; ENSG00000196091 [Q00872-7]
ENST00000452455; ENSP00000400908; ENSG00000196091 [Q00872-6]
ENST00000536007; ENSP00000446128; ENSG00000196091 [Q00872-9]
ENST00000541119; ENSP00000442847; ENSG00000196091 [Q00872-8]
ENST00000545503; ENSP00000440034; ENSG00000196091 [Q00872-10]
ENST00000547405; ENSP00000448175; ENSG00000196091 [Q00872-5]
ENST00000550270; ENSP00000449702; ENSG00000196091 [Q00872-1]
ENST00000553190; ENSP00000447900; ENSG00000196091 [Q00872-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4604

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4604

UCSC genome browser

More...
UCSCi
uc001tig.4 human [Q00872-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X66276 mRNA Translation: CAA46987.1
X73114 mRNA Translation: CAA51545.1
AK295727 mRNA Translation: BAG58568.1
AK296681 mRNA Translation: BAG59277.1
AK303401 mRNA Translation: BAH13954.1
AL831993 mRNA Translation: CAD89907.1
AL832000 mRNA Translation: CAD91144.1
AL834249 mRNA Translation: CAD38925.1
AC010205 Genomic DNA No translation available.
AC090671 Genomic DNA No translation available.
AC117505 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97665.1
CH471054 Genomic DNA Translation: EAW97669.1
CH471054 Genomic DNA Translation: EAW97672.1
BC092418 mRNA Translation: AAH92418.1
BC117217 mRNA Translation: AAI17218.1
BC143495 mRNA Translation: AAI43496.1
BC143502 mRNA Translation: AAI43503.1
BC143503 mRNA Translation: AAI43504.1
BC143504 mRNA Translation: AAI43505.1
CCDSiCCDS55877.1 [Q00872-3]
CCDS58268.1 [Q00872-6]
CCDS58269.1 [Q00872-10]
CCDS58270.1 [Q00872-9]
CCDS58271.1 [Q00872-8]
CCDS58272.1 [Q00872-7]
CCDS58273.1 [Q00872-5]
CCDS9083.1 [Q00872-4]
CCDS9084.1 [Q00872-2]
CCDS9085.1 [Q00872-1]
PIRiS24614
S36846
RefSeqiNP_001241647.1, NM_001254718.1 [Q00872-6]
NP_001241648.1, NM_001254719.1 [Q00872-10]
NP_001241649.1, NM_001254720.1 [Q00872-8]
NP_001241650.1, NM_001254721.1 [Q00872-9]
NP_001241651.1, NM_001254722.1 [Q00872-5]
NP_001241652.1, NM_001254723.1 [Q00872-7]
NP_002456.2, NM_002465.3 [Q00872-4]
NP_996555.1, NM_206819.2 [Q00872-2]
NP_996556.1, NM_206820.2 [Q00872-1]
NP_996557.1, NM_206821.2 [Q00872-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X44NMR-A342-431[»]
2DAVNMR-A58-170[»]
2YUVNMR-A252-338[»]
2YUWNMR-A718-832[»]
2YUXNMR-A922-1034[»]
2YUZNMR-A433-519[»]
2YXMX-ray1.51A252-338[»]
SMRiQ00872
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110689, 12 interactors
IntActiQ00872, 19 interactors
STRINGi9606.ENSP00000400908

PTM databases

iPTMnetiQ00872
PhosphoSitePlusiQ00872

Polymorphism and mutation databases

BioMutaiMYBPC1
DMDMi6166597

Proteomic databases

MassIVEiQ00872
PaxDbiQ00872
PeptideAtlasiQ00872
PRIDEiQ00872
ProteomicsDBi18023
18903
33729
57876 [Q00872-1]
57877 [Q00872-2]
57878 [Q00872-3]
61165
7205
7206
7207

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
17936 288 antibodies

The DNASU plasmid repository

More...
DNASUi
4604

Genome annotation databases

EnsembliENST00000361466; ENSP00000354849; ENSG00000196091 [Q00872-4]
ENST00000361685; ENSP00000354845; ENSG00000196091 [Q00872-2]
ENST00000392934; ENSP00000376665; ENSG00000196091 [Q00872-7]
ENST00000452455; ENSP00000400908; ENSG00000196091 [Q00872-6]
ENST00000536007; ENSP00000446128; ENSG00000196091 [Q00872-9]
ENST00000541119; ENSP00000442847; ENSG00000196091 [Q00872-8]
ENST00000545503; ENSP00000440034; ENSG00000196091 [Q00872-10]
ENST00000547405; ENSP00000448175; ENSG00000196091 [Q00872-5]
ENST00000550270; ENSP00000449702; ENSG00000196091 [Q00872-1]
ENST00000553190; ENSP00000447900; ENSG00000196091 [Q00872-3]
GeneIDi4604
KEGGihsa:4604
UCSCiuc001tig.4 human [Q00872-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4604
DisGeNETi4604
EuPathDBiHostDB:ENSG00000196091.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MYBPC1
HGNCiHGNC:7549 MYBPC1
HPAiENSG00000196091 Tissue enriched (skeletal)
MalaCardsiMYBPC1
MIMi160794 gene
614335 phenotype
614915 phenotype
618524 phenotype
neXtProtiNX_Q00872
OpenTargetsiENSG00000196091
Orphaneti1146 Digitotalar dysmorphism
137783 Lethal congenital contracture syndrome type 3
498693 MYBPC1-related autosomal recessive non-lethal arthrogryposis multiplex congenita syndrome
PharmGKBiPA31349

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFCI Eukaryota
ENOG4110AYI LUCA
GeneTreeiENSGT00940000158254
InParanoidiQ00872
KOiK12557
OMAiCFEGTDE
OrthoDBi67092at2759
PhylomeDBiQ00872
TreeFamiTF351819

Enzyme and pathway databases

ReactomeiR-HSA-390522 Striated Muscle Contraction

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
4604 4 hits in 788 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MYBPC1 human
EvolutionaryTraceiQ00872

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MYBPC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4604
PharosiQ00872 Tbio

Protein Ontology

More...
PROi
PR:Q00872
RNActiQ00872 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196091 Expressed in skeletal muscle tissue of rectus abdominis and 168 other tissues
ExpressionAtlasiQ00872 baseline and differential
GenevisibleiQ00872 HS

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 10 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040849 MyBP-C_THB
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 7 hits
PF18362 THB, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 7 hits
SM00408 IGc2, 4 hits
SUPFAMiSSF48726 SSF48726, 7 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYPC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q00872
Secondary accession number(s): B4DKR5
, B7Z8G8, B7ZL02, B7ZL09, B7ZL10, E7ESM5, E7EWS6, G3XAE8, Q15497, Q17RR7, Q569K7, Q86T48, Q86TC8, Q8N3L2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 15, 1999
Last modified: June 17, 2020
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again