Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (12 Aug 2020)
Sequence version 3 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Plasma membrane calcium-transporting ATPase 1

Gene

ATP2B1

Organism
Oryctolagus cuniculus (Rabbit)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolysis of ATP coupled with the transport of calcium from the cytoplasm to the extracellular space thereby maintaining intracellular calcium homeostasis. Plays a role in blood pressure regulation through regulation of intracellular calcium concentration and nitric oxide production leading to regulation of vascular smooth muscle cells vasoconstriction. Positively regulates bone mineralization through absorption of calcium from the intestine. Plays dual roles in osteoclast differentiation and survival by regulating RANKL-induced calcium oscillations in preosteoclasts and mediating calcium extrusion in mature osteoclasts (By similarity). Regulates insulin sensitivity through calcium/calmodulin signaling pathway by regulating AKT1 activation and NOS3 activation in endothelial cells (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei4754-aspartylphosphate intermediateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi475MagnesiumBy similarity1
Metal bindingi477Magnesium; via carbonyl oxygenBy similarity1
Metal bindingi797MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Translocase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 1By similarity (EC:7.2.2.10By similarity)
Alternative name(s):
Plasma membrane calcium ATPase isoform 1By similarity
Short name:
PMCA1By similarity
Plasma membrane calcium pump isoform 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP2B1By similarity
Synonyms:PMCA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiOryctolagus cuniculus (Rabbit)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9986 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresLagomorphaLeporidaeOryctolagus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001811 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 105CytoplasmicCuratedAdd BLAST104
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei106 – 126HelicalBy similarityAdd BLAST21
Topological domaini127 – 154ExtracellularCuratedAdd BLAST28
Transmembranei155 – 175HelicalBy similarityAdd BLAST21
Topological domaini176 – 366CytoplasmicCuratedAdd BLAST191
Transmembranei367 – 386HelicalBy similarityAdd BLAST20
Topological domaini387 – 418ExtracellularCuratedAdd BLAST32
Transmembranei419 – 439HelicalSequence analysisAdd BLAST21
Topological domaini440 – 855CytoplasmicCuratedAdd BLAST416
Transmembranei856 – 876HelicalSequence analysisAdd BLAST21
Topological domaini877 – 882ExtracellularCurated6
Transmembranei883 – 903HelicalSequence analysisAdd BLAST21
Topological domaini904 – 927CytoplasmicCuratedAdd BLAST24
Transmembranei928 – 948HelicalBy similarityAdd BLAST21
Topological domaini949 – 971ExtracellularCuratedAdd BLAST23
Transmembranei972 – 991HelicalBy similarityAdd BLAST20
Topological domaini992 – 1005CytoplasmicCuratedAdd BLAST14
Transmembranei1006 – 1027HelicalBy similarityAdd BLAST22
Topological domaini1028 – 1039ExtracellularCuratedAdd BLAST12
Transmembranei1040 – 1060HelicalBy similarityAdd BLAST21
Topological domaini1061 – 1220CytoplasmicCuratedAdd BLAST160

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462112 – 1220Plasma membrane calcium-transporting ATPase 1Add BLAST1219

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylglycineBy similarity1
Modified residuei8PhosphoserineBy similarity1
Modified residuei17PhosphoserineBy similarity1
Modified residuei338PhosphoserineBy similarity1
Modified residuei1116Phosphothreonine; by PKCBy similarity1
Modified residuei1140PhosphoserineBy similarity1
Modified residuei1155PhosphoserineBy similarity1
Modified residuei1165PhosphothreonineBy similarity1
Modified residuei1177Phosphoserine; by PKABy similarity1
Modified residuei1178PhosphoserineBy similarity1
Modified residuei1182PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q00804

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform B is ubiquitously expressed and is the most predominant isoform. Isoform C is expressed at much lower levels in all tissues tested, but liver, while isoform A is found only in aorta, brain and stomach.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Dimer. Oligomer. Calmodulin binding.

Interacts with PDZD11.

Interacts with SLC35G1 and STIM1.

Interacts with YWHAE; interacts with the monomeric and dimeric forms of the YWHAE but prefer the monomer form; this interaction inhibits calcium-transporting ATPase activity (By similarity).

Interacts with NPTN; this interaction stabilizes ATP2B1 and increases ATPase activity; this interaction controls T cell calcium homeostasis following T cell activation.

Interacts with EPB41; regulates small intestinal calcium absorption through regulation of membrane expression of ATP2B1 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9986.ENSOCUP00000014188

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1100 – 1117Calmodulin-binding subdomain ABy similarityAdd BLAST18
Regioni1118 – 1220Required for basolateral membrane targetingBy similarityAdd BLAST103

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi296 – 299Poly-Glu4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoforms A and C contain and additional calmodulin-binding subdomain B which is different in the different splice variants and shows pH dependent calmodulin binding properties.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0204, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q00804

KEGG Orthology (KO)

More...
KOi
K05850

Database of Orthologous Groups

More...
OrthoDBi
115892at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030320, ATP2B1
IPR022141, ATP_Ca_trans_C
IPR006068, ATPase_P-typ_cation-transptr_C
IPR004014, ATPase_P-typ_cation-transptr_N
IPR023299, ATPase_P-typ_cyto_dom_N
IPR018303, ATPase_P-typ_P_site
IPR023298, ATPase_P-typ_TM_dom_sf
IPR008250, ATPase_P-typ_transduc_dom_A_sf
IPR036412, HAD-like_sf
IPR023214, HAD_sf
IPR006408, P-type_ATPase_IIB
IPR001757, P_typ_ATPase

The PANTHER Classification System

More...
PANTHERi
PTHR24093:SF245, PTHR24093:SF245, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12424, ATP_Ca_trans_C, 1 hit
PF00689, Cation_ATPase_C, 1 hit
PF00690, Cation_ATPase_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00831, Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784, SSF56784, 1 hit
SSF81653, SSF81653, 1 hit
SSF81660, SSF81660, 1 hit
SSF81665, SSF81665, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01517, ATPase-IIB_Ca, 1 hit
TIGR01494, ATPase_P-type, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00154, ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B (identifier: Q00804-3) [UniParc]FASTAAdd to basket
Also known as: CI

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDMANNSVV YGGVKNSLKE ANHDGDFGIT LAAVRALMEL RSTDALRKIL
60 70 80 90 100
ESYGDVYGIC TKLKTSPNEG LRGNPADLER REAVFGKNFI PPKKPKTFLQ
110 120 130 140 150
LVWEALQDVT LIILEIAAIV SLGLSFYQPP EGDNALCGEV SVGEEEGEGE
160 170 180 190 200
TGWIEGAAIL LSVVCVVLVT AFNDWSKEKQ FRGLQSRIEQ EQKFTVIRGG
210 220 230 240 250
QVIQIPVSDI TVGDIAQVKY GDLLPADGIL IQGNDLKIDE SSLTGESDHV
260 270 280 290 300
KKSLDKDPLL LSGTHVMEGS GRMVVTAVGV NSQTGIIFTL LGAGGEEEEK
310 320 330 340 350
KDEKKKEKKN KKQDGAIENR NKAKAQDGEP MEMQPLKSEE GGDGDEKDKK
360 370 380 390 400
KANLPKKEKS VLQGKLTKLA VQIGKAGLLM SAITVIILVL YFLIDTFWVQ
410 420 430 440 450
KRPWLAECTP IYIQYFVKFF IIGVTVLVVA VPEGLPLPVT ISLAYSVNEM
460 470 480 490 500
MKDNNLVRHL DACETMGNAT AICSDKTGTL TMNRMAVVQA YINEKHYKKV
510 520 530 540 550
PEPEPYPPNI LSYLVTGISV NCAYTSKILP PEEEGGLPRI VGNKTECALL
560 570 580 590 600
GPLLDLKQDY QDVRNEIPEE ALYKVYTFQS VRKSMSTVLK NSDGSFRIFS
610 620 630 640 650
KGASEIILKK CFKILSANGE AKVFRPRDRD DIVKTVIEPM ASEGLRTICL
660 670 680 690 700
AFRDFPAGEP EPEWDNENDI VTGLTCIAVV GIEDPGRPEV ADAIKKCQRA
710 720 730 740 750
GITVEVVTGD NINTARAIAT KCGILHPGED FLCLEGKDFN RRIRNEKGEI
760 770 780 790 800
EQESIDKIWP KLRVLARSSP TDKHTLVKGI IDSTVSEQRQ VVAVTGDGTN
810 820 830 840 850
DGPALKKADG GFAMGIAGTD VAKEASDIIL TDDNFTSIVK AVMWGRNVYD
860 870 880 890 900
SISKFLQFQL TVNVVAVIVA FTGACITQDS PLKAVQMLWV NLIMDTLASL
910 920 930 940 950
ALATEPPTES LLLGKPYGRN KPLISRTMMK NILGHAFYQL VVVFTLLLAG
960 970 980 990 1000
EKFFDIDSGR NAPLHAPPSE HYTIVFNIFV LMQLFNEINA RKIHGERNVF
1010 1020 1030 1040 1050
EGIFNNAIFC TIVLGTFVVQ IIIVQFAGKP FSCSELSVEQ WLWSIFLGMG
1060 1070 1080 1090 1100
TLLWGQLIST IPTSRLKFQK EVVHGTQKRE IGEEELAEDV EEIVHAEREL
1110 1120 1130 1140 1150
RRWQILWFRG LNRIQTQIRV VNAFRSSLYE GLEKPESRSS IHNFMTHPEF
1160 1170 1180 1190 1200
RIEDSEPHIP LIDDTDAEDD APTKRNSSPP PSPNKNNNLV DSGIHLTIEM
1210 1220
NKSATSSSPG SPLHSLETSL
Length:1,220
Mass (Da):134,651
Last modified:September 12, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7E98CF428DC2CDD1
GO
Isoform C (identifier: Q00804-1) [UniParc]FASTAAdd to basket
Also known as: CIII

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1117: Q → QMDVVNAFQSGSSIQGALRRQPSIASQHHD

Show »
Length:1,249
Mass (Da):137,770
Checksum:iD3EEAA2861621FEA
GO
Isoform A (identifier: Q00804-2) [UniParc]FASTAAdd to basket
Also known as: CII

The sequence of this isoform differs from the canonical sequence as follows:
     1118-1119: IR → MD
     1125-1220: RSSLYEGLEK...SPLHSLETSL → QSGSSIQGAL...VGYSSGECIS

Show »
Length:1,176
Mass (Da):129,440
Checksum:i8F752C76121EBC9C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0597771117Q → QMDVVNAFQSGSSIQGALRR QPSIASQHHD in isoform C. 1
Alternative sequenceiVSP_0597781118 – 1119IR → MD in isoform A. 2
Alternative sequenceiVSP_0597791125 – 1220RSSLY…LETSL → QSGSSIQGALRRQPSIASQH HDVTNISTPTHVVFSSSTAS TTVGYSSGECIS in isoform A. Add BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X59069 mRNA Translation: CAA41792.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S17179

NCBI Reference Sequences

More...
RefSeqi
NP_001095189.1, NM_001101719.1 [Q00804-3]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100009543

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ocu:100009543

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X59069 mRNA Translation: CAA41792.1
PIRiS17179
RefSeqiNP_001095189.1, NM_001101719.1 [Q00804-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9986.ENSOCUP00000014188

Proteomic databases

PRIDEiQ00804

Genome annotation databases

GeneIDi100009543
KEGGiocu:100009543

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
490

Phylogenomic databases

eggNOGiKOG0204, Eukaryota
InParanoidiQ00804
KOiK05850
OrthoDBi115892at2759

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR030320, ATP2B1
IPR022141, ATP_Ca_trans_C
IPR006068, ATPase_P-typ_cation-transptr_C
IPR004014, ATPase_P-typ_cation-transptr_N
IPR023299, ATPase_P-typ_cyto_dom_N
IPR018303, ATPase_P-typ_P_site
IPR023298, ATPase_P-typ_TM_dom_sf
IPR008250, ATPase_P-typ_transduc_dom_A_sf
IPR036412, HAD-like_sf
IPR023214, HAD_sf
IPR006408, P-type_ATPase_IIB
IPR001757, P_typ_ATPase
PANTHERiPTHR24093:SF245, PTHR24093:SF245, 1 hit
PfamiView protein in Pfam
PF12424, ATP_Ca_trans_C, 1 hit
PF00689, Cation_ATPase_C, 1 hit
PF00690, Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831, Cation_ATPase_N, 1 hit
SUPFAMiSSF56784, SSF56784, 1 hit
SSF81653, SSF81653, 1 hit
SSF81660, SSF81660, 1 hit
SSF81665, SSF81665, 1 hit
TIGRFAMsiTIGR01517, ATPase-IIB_Ca, 1 hit
TIGR01494, ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154, ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2B1_RABIT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q00804
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: September 12, 2018
Last modified: August 12, 2020
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again