Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vascular endothelial growth factor A

Gene

Vegfa

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity). Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (PubMed:26503042).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Growth factor, Heparin-binding, Mitogen
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-114608 Platelet degranulation
R-MMU-194313 VEGF ligand-receptor interactions
R-MMU-195399 VEGF binds to VEGFR leading to receptor dimerization
R-MMU-3928662 EPHB-mediated forward signaling
R-MMU-4420097 VEGFA-VEGFR2 Pathway
R-MMU-5218921 VEGFR2 mediated cell proliferation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vascular endothelial growth factor A
Short name:
VEGF-A
Alternative name(s):
Vascular permeability factor
Short name:
VPF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Vegfa
Synonyms:Vegf
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:103178 Vegfa

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26By similarityAdd BLAST26
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002338827 – 214Vascular endothelial growth factor AAdd BLAST188

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi51 ↔ 93By similarity
Disulfide bondi76InterchainBy similarity
Disulfide bondi82 ↔ 127By similarity
Disulfide bondi85InterchainBy similarity
Disulfide bondi86 ↔ 129By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi100N-linked (GlcNAc...) asparagineCurated1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q00731

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q00731

PRoteomics IDEntifications database

More...
PRIDEi
Q00731

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q00731

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By IL-6 and FSH in vitro.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000023951 Expressed in 307 organ(s), highest expression level in lung

CleanEx database of gene expression profiles

More...
CleanExi
MM_VEGFA

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q00731 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q00731 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity). Interacts with NRP1 (PubMed:26503042).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
204512, 2 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-3160 Vascular endothelial growth factor A complex

Database of interacting proteins

More...
DIPi
DIP-31909N

Protein interaction database and analysis system

More...
IntActi
Q00731, 3 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000115883

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q00731

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q00731

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoform VEGF-3 contains a basic insert which acts as a cell retention signal.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PDGF/VEGF growth factor family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGCM Eukaryota
ENOG410ZWYU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157284

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230896

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000105

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q00731

KEGG Orthology (KO)

More...
KOi
K05448

Database of Orthologous Groups

More...
OrthoDBi
1364454at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q00731

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00135 PDGF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.10.160.10, 1 hit
2.10.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR023581 PD_growth_factor_CS
IPR000072 PDGF/VEGF_dom
IPR027928 VEGF_C
IPR036841 VEGF_C_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00341 PDGF, 1 hit
PF14554 VEGF_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00141 PDGF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57501 SSF57501, 1 hit
SSF57593 SSF57593, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00249 PDGF_1, 1 hit
PS50278 PDGF_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform VEGF-3 (identifier: Q00731-1) [UniParc]FASTAAdd to basket
Also known as: VEGF188

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY
60 70 80 90 100
CRPIETLVDI FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN
110 120 130 140 150
ITMQIMRIKP HQSQHIGEMS FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ
160 170 180 190 200
KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD PQTCKCSCKN TDSRCKARQL
210
ELNERTCRCD KPRR
Length:214
Mass (Da):25,283
Last modified:October 1, 1996 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB5540B51E4BB6E17
GO
Isoform VEGF-1 (identifier: Q00731-2) [UniParc]FASTAAdd to basket
Also known as: VEGF164

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: K → N
     141-164: Missing.

Show »
Length:190
Mass (Da):22,440
Checksum:i7B0BE0B9541E3805
GO
Isoform VEGF-2 (identifier: Q00731-3) [UniParc]FASTAAdd to basket
Also known as: VEGF120

The sequence of this isoform differs from the canonical sequence as follows:
     141-208: Missing.

Show »
Length:146
Mass (Da):17,233
Checksum:i30635EADAD328C29
GO
Isoform VEGF-4 (identifier: Q00731-4) [UniParc]FASTAAdd to basket
Also known as: VEGF115

The sequence of this isoform differs from the canonical sequence as follows:
     105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW
     142-214: Missing.

Show »
Length:141
Mass (Da):15,584
Checksum:iA9AC452E770CC338
GO
Isoform VEGF-5 (identifier: Q00731-5) [UniParc]FASTAAdd to basket
Also known as: VEGF102

The sequence of this isoform differs from the canonical sequence as follows:
     105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH
     129-214: Missing.

Show »
Length:128
Mass (Da):14,309
Checksum:i44405AD86973E191
GO
Isoform L-VEGF-1 (identifier: Q00731-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     140-140: K → N
     141-164: Missing.

Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.
Show »
Length:368
Mass (Da):40,288
Checksum:i8B8EAC32ADE8BDFD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q4N8E9Q4N8_MOUSE
Vascular endothelial growth factor ...
Vegfa
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q4N9E9Q4N9_MOUSE
Vascular endothelial growth factor ...
Vegfa
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WH81F8WH81_MOUSE
Vascular endothelial growth factor ...
Vegfa
392Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SVG2A0A1L1SVG2_MOUSE
Vascular endothelial growth factor ...
Vegfa
392Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WH10F8WH10_MOUSE
Vascular endothelial growth factor ...
Vegfa
368Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZE01F6ZE01_MOUSE
Vascular endothelial growth factor ...
Vegfa
324Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH61468 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61F → I in AAC05442 (PubMed:9446618).Curated1
Sequence conflicti117 – 118GE → ER in AAA40547 (PubMed:1644816).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0387461M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1. Curated1
Alternative sequenceiVSP_016418105 – 141IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_016419105 – 128IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_016420129 – 214Missing in isoform VEGF-5. 1 PublicationAdd BLAST86
Alternative sequenceiVSP_004626140K → N in isoform VEGF-1 and isoform L-VEGF-1. 2 Publications1
Alternative sequenceiVSP_004628141 – 208Missing in isoform VEGF-2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_004627141 – 164Missing in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_016421142 – 214Missing in isoform VEGF-4. 1 PublicationAdd BLAST73

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
S37052 mRNA Translation: AAB22252.1
S38083 mRNA Translation: AAB22253.1
S38100 mRNA Translation: AAB22254.1
M95200 mRNA Translation: AAA40547.1
U50279 mRNA Translation: AAC05442.1
AY263146 mRNA Translation: AAP86647.1
AC127690 Genomic DNA No translation available.
BC061468 mRNA Translation: AAH61468.1 Different initiation.
AY707864 mRNA Translation: AAU11325.1
AY750956 mRNA Translation: AAU95484.1
AY750957 mRNA Translation: AAU95485.1
U41383 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28818.2 [Q00731-6]
CCDS70817.1 [Q00731-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A44881
B44881

NCBI Reference Sequences

More...
RefSeqi
NP_001020421.2, NM_001025250.3
NP_001020428.2, NM_001025257.3
NP_001103736.1, NM_001110266.1
NP_001103737.1, NM_001110267.1
NP_001103738.1, NM_001110268.1
NP_001273985.1, NM_001287056.1 [Q00731-1]
NP_001273986.1, NM_001287057.1 [Q00731-2]
NP_001273987.1, NM_001287058.1 [Q00731-3]
NP_001303970.1, NM_001317041.1
NP_033531.3, NM_009505.4 [Q00731-6]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.282184

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951 [Q00731-3]
ENSMUST00000214739; ENSMUSP00000149539; ENSMUSG00000023951 [Q00731-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22339

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:22339

UCSC genome browser

More...
UCSCi
uc008crn.4 mouse [Q00731-1]
uc008cro.4 mouse [Q00731-2]
uc008crp.4 mouse [Q00731-3]
uc008crr.3 mouse [Q00731-5]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA Translation: AAB22252.1
S38083 mRNA Translation: AAB22253.1
S38100 mRNA Translation: AAB22254.1
M95200 mRNA Translation: AAA40547.1
U50279 mRNA Translation: AAC05442.1
AY263146 mRNA Translation: AAP86647.1
AC127690 Genomic DNA No translation available.
BC061468 mRNA Translation: AAH61468.1 Different initiation.
AY707864 mRNA Translation: AAU11325.1
AY750956 mRNA Translation: AAU95484.1
AY750957 mRNA Translation: AAU95485.1
U41383 Genomic DNA No translation available.
CCDSiCCDS28818.2 [Q00731-6]
CCDS70817.1 [Q00731-3]
PIRiA44881
B44881
RefSeqiNP_001020421.2, NM_001025250.3
NP_001020428.2, NM_001025257.3
NP_001103736.1, NM_001110266.1
NP_001103737.1, NM_001110267.1
NP_001103738.1, NM_001110268.1
NP_001273985.1, NM_001287056.1 [Q00731-1]
NP_001273986.1, NM_001287057.1 [Q00731-2]
NP_001273987.1, NM_001287058.1 [Q00731-3]
NP_001303970.1, NM_001317041.1
NP_033531.3, NM_009505.4 [Q00731-6]
UniGeneiMm.282184

3D structure databases

ProteinModelPortaliQ00731
SMRiQ00731
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204512, 2 interactors
ComplexPortaliCPX-3160 Vascular endothelial growth factor A complex
DIPiDIP-31909N
IntActiQ00731, 3 interactors
STRINGi10090.ENSMUSP00000115883

PTM databases

PhosphoSitePlusiQ00731

Proteomic databases

MaxQBiQ00731
PaxDbiQ00731
PRIDEiQ00731

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951 [Q00731-3]
ENSMUST00000214739; ENSMUSP00000149539; ENSMUSG00000023951 [Q00731-6]
GeneIDi22339
KEGGimmu:22339
UCSCiuc008crn.4 mouse [Q00731-1]
uc008cro.4 mouse [Q00731-2]
uc008crp.4 mouse [Q00731-3]
uc008crr.3 mouse [Q00731-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7422
MGIiMGI:103178 Vegfa

Phylogenomic databases

eggNOGiENOG410IGCM Eukaryota
ENOG410ZWYU LUCA
GeneTreeiENSGT00940000157284
HOGENOMiHOG000230896
HOVERGENiHBG000105
InParanoidiQ00731
KOiK05448
OrthoDBi1364454at2759
PhylomeDBiQ00731

Enzyme and pathway databases

ReactomeiR-MMU-114608 Platelet degranulation
R-MMU-194313 VEGF ligand-receptor interactions
R-MMU-195399 VEGF binds to VEGFR leading to receptor dimerization
R-MMU-3928662 EPHB-mediated forward signaling
R-MMU-4420097 VEGFA-VEGFR2 Pathway
R-MMU-5218921 VEGFR2 mediated cell proliferation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Vegfa mouse

Protein Ontology

More...
PROi
PR:Q00731

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000023951 Expressed in 307 organ(s), highest expression level in lung
CleanExiMM_VEGFA
ExpressionAtlasiQ00731 baseline and differential
GenevisibleiQ00731 MM

Family and domain databases

CDDicd00135 PDGF, 1 hit
Gene3Di2.10.160.10, 1 hit
2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR023581 PD_growth_factor_CS
IPR000072 PDGF/VEGF_dom
IPR027928 VEGF_C
IPR036841 VEGF_C_sf
PfamiView protein in Pfam
PF00341 PDGF, 1 hit
PF14554 VEGF_C, 1 hit
SMARTiView protein in SMART
SM00141 PDGF, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
SSF57593 SSF57593, 1 hit
PROSITEiView protein in PROSITE
PS00249 PDGF_1, 1 hit
PS50278 PDGF_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVEGFA_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q00731
Secondary accession number(s): O70123
, Q66S31, Q6GT23, Q6WZL9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: January 16, 2019
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again