Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vascular endothelial growth factor A

Gene

Vegfa

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity). Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (PubMed:26503042).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Growth factor, Heparin-binding, Mitogen
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

ReactomeiR-MMU-114608 Platelet degranulation
R-MMU-194313 VEGF ligand-receptor interactions
R-MMU-195399 VEGF binds to VEGFR leading to receptor dimerization
R-MMU-3928662 EPHB-mediated forward signaling
R-MMU-4420097 VEGFA-VEGFR2 Pathway
R-MMU-5218921 VEGFR2 mediated cell proliferation

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular endothelial growth factor A
Short name:
VEGF-A
Alternative name(s):
Vascular permeability factor
Short name:
VPF
Gene namesi
Name:Vegfa
Synonyms:Vegf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:103178 Vegfa

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 26By similarityAdd BLAST26
ChainiPRO_000002338827 – 214Vascular endothelial growth factor AAdd BLAST188

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi51 ↔ 93By similarity
Disulfide bondi76InterchainBy similarity
Disulfide bondi82 ↔ 127By similarity
Disulfide bondi85InterchainBy similarity
Disulfide bondi86 ↔ 129By similarity
Glycosylationi100N-linked (GlcNAc...) asparagineCurated1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ00731
PaxDbiQ00731
PRIDEiQ00731

PTM databases

PhosphoSitePlusiQ00731

Expressioni

Tissue specificityi

In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

Developmental stagei

Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution.1 Publication

Inductioni

By IL-6 and FSH in vitro.1 Publication

Gene expression databases

BgeeiENSMUSG00000023951 Expressed in 307 organ(s), highest expression level in lung
CleanExiMM_VEGFA
ExpressionAtlasiQ00731 baseline and differential
GenevisibleiQ00731 MM

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity). Interacts with NRP1 (PubMed:26503042).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204512, 2 interactors
ComplexPortaliCPX-3160 Vascular endothelial growth factor A complex
DIPiDIP-31909N
IntActiQ00731, 3 interactors
STRINGi10090.ENSMUSP00000115883

Structurei

3D structure databases

ProteinModelPortaliQ00731
SMRiQ00731
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

Isoform VEGF-3 contains a basic insert which acts as a cell retention signal.

Sequence similaritiesi

Belongs to the PDGF/VEGF growth factor family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IGCM Eukaryota
ENOG410ZWYU LUCA
GeneTreeiENSGT00730000110791
HOGENOMiHOG000230896
HOVERGENiHBG000105
InParanoidiQ00731
KOiK05448
PhylomeDBiQ00731

Family and domain databases

CDDicd00135 PDGF, 1 hit
Gene3Di2.10.160.10, 1 hit
2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR023581 PD_growth_factor_CS
IPR000072 PDGF/VEGF_dom
IPR027928 VEGF_C
IPR036841 VEGF_C_sf
PfamiView protein in Pfam
PF00341 PDGF, 1 hit
PF14554 VEGF_C, 1 hit
SMARTiView protein in SMART
SM00141 PDGF, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
SSF57593 SSF57593, 1 hit
PROSITEiView protein in PROSITE
PS00249 PDGF_1, 1 hit
PS50278 PDGF_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.iShow all

Isoform VEGF-3 (identifier: Q00731-1) [UniParc]FASTAAdd to basket
Also known as: VEGF188

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY
60 70 80 90 100
CRPIETLVDI FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN
110 120 130 140 150
ITMQIMRIKP HQSQHIGEMS FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ
160 170 180 190 200
KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD PQTCKCSCKN TDSRCKARQL
210
ELNERTCRCD KPRR
Length:214
Mass (Da):25,283
Last modified:October 1, 1996 - v2
Checksum:iB5540B51E4BB6E17
GO
Isoform VEGF-1 (identifier: Q00731-2) [UniParc]FASTAAdd to basket
Also known as: VEGF164

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: K → N
     141-164: Missing.

Show »
Length:190
Mass (Da):22,440
Checksum:i7B0BE0B9541E3805
GO
Isoform VEGF-2 (identifier: Q00731-3) [UniParc]FASTAAdd to basket
Also known as: VEGF120

The sequence of this isoform differs from the canonical sequence as follows:
     141-208: Missing.

Show »
Length:146
Mass (Da):17,233
Checksum:i30635EADAD328C29
GO
Isoform VEGF-4 (identifier: Q00731-4) [UniParc]FASTAAdd to basket
Also known as: VEGF115

The sequence of this isoform differs from the canonical sequence as follows:
     105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW
     142-214: Missing.

Show »
Length:141
Mass (Da):15,584
Checksum:iA9AC452E770CC338
GO
Isoform VEGF-5 (identifier: Q00731-5) [UniParc]FASTAAdd to basket
Also known as: VEGF102

The sequence of this isoform differs from the canonical sequence as follows:
     105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH
     129-214: Missing.

Show »
Length:128
Mass (Da):14,309
Checksum:i44405AD86973E191
GO
Isoform L-VEGF-1 (identifier: Q00731-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     140-140: K → N
     141-164: Missing.

Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.
Show »
Length:368
Mass (Da):40,288
Checksum:i8B8EAC32ADE8BDFD
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q4N8E9Q4N8_MOUSE
Vascular endothelial growth factor ...
Vegfa
208Annotation score:
E9Q4N9E9Q4N9_MOUSE
Vascular endothelial growth factor ...
Vegfa
170Annotation score:
F8WH81F8WH81_MOUSE
Vascular endothelial growth factor ...
Vegfa
392Annotation score:
F8WH10F8WH10_MOUSE
Vascular endothelial growth factor ...
Vegfa
368Annotation score:
A0A1L1SVG2A0A1L1SVG2_MOUSE
Vascular endothelial growth factor ...
Vegfa
392Annotation score:
F6ZE01F6ZE01_MOUSE
Vascular endothelial growth factor ...
Vegfa
324Annotation score:

Sequence cautioni

The sequence AAH61468 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti61F → I in AAC05442 (PubMed:9446618).Curated1
Sequence conflicti117 – 118GE → ER in AAA40547 (PubMed:1644816).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387461M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1. Curated1
Alternative sequenceiVSP_016418105 – 141IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_016419105 – 128IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_016420129 – 214Missing in isoform VEGF-5. 1 PublicationAdd BLAST86
Alternative sequenceiVSP_004626140K → N in isoform VEGF-1 and isoform L-VEGF-1. 2 Publications1
Alternative sequenceiVSP_004628141 – 208Missing in isoform VEGF-2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_004627141 – 164Missing in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_016421142 – 214Missing in isoform VEGF-4. 1 PublicationAdd BLAST73

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA Translation: AAB22252.1
S38083 mRNA Translation: AAB22253.1
S38100 mRNA Translation: AAB22254.1
M95200 mRNA Translation: AAA40547.1
U50279 mRNA Translation: AAC05442.1
AY263146 mRNA Translation: AAP86647.1
AC127690 Genomic DNA No translation available.
BC061468 mRNA Translation: AAH61468.1 Different initiation.
AY707864 mRNA Translation: AAU11325.1
AY750956 mRNA Translation: AAU95484.1
AY750957 mRNA Translation: AAU95485.1
U41383 Genomic DNA No translation available.
CCDSiCCDS28818.2 [Q00731-6]
CCDS70817.1 [Q00731-3]
PIRiA44881
B44881
RefSeqiNP_001020421.2, NM_001025250.3
NP_001020428.2, NM_001025257.3
NP_001103736.1, NM_001110266.1
NP_001103737.1, NM_001110267.1
NP_001103738.1, NM_001110268.1
NP_001273985.1, NM_001287056.1 [Q00731-1]
NP_001273986.1, NM_001287057.1 [Q00731-2]
NP_001273987.1, NM_001287058.1 [Q00731-3]
NP_001303970.1, NM_001317041.1
NP_033531.3, NM_009505.4 [Q00731-6]
UniGeneiMm.282184

Genome annotation databases

EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951 [Q00731-3]
ENSMUST00000214739; ENSMUSP00000149539; ENSMUSG00000023951 [Q00731-6]
GeneIDi22339
KEGGimmu:22339
UCSCiuc008crn.4 mouse [Q00731-1]
uc008cro.4 mouse [Q00731-2]
uc008crp.4 mouse [Q00731-3]
uc008crr.3 mouse [Q00731-5]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA Translation: AAB22252.1
S38083 mRNA Translation: AAB22253.1
S38100 mRNA Translation: AAB22254.1
M95200 mRNA Translation: AAA40547.1
U50279 mRNA Translation: AAC05442.1
AY263146 mRNA Translation: AAP86647.1
AC127690 Genomic DNA No translation available.
BC061468 mRNA Translation: AAH61468.1 Different initiation.
AY707864 mRNA Translation: AAU11325.1
AY750956 mRNA Translation: AAU95484.1
AY750957 mRNA Translation: AAU95485.1
U41383 Genomic DNA No translation available.
CCDSiCCDS28818.2 [Q00731-6]
CCDS70817.1 [Q00731-3]
PIRiA44881
B44881
RefSeqiNP_001020421.2, NM_001025250.3
NP_001020428.2, NM_001025257.3
NP_001103736.1, NM_001110266.1
NP_001103737.1, NM_001110267.1
NP_001103738.1, NM_001110268.1
NP_001273985.1, NM_001287056.1 [Q00731-1]
NP_001273986.1, NM_001287057.1 [Q00731-2]
NP_001273987.1, NM_001287058.1 [Q00731-3]
NP_001303970.1, NM_001317041.1
NP_033531.3, NM_009505.4 [Q00731-6]
UniGeneiMm.282184

3D structure databases

ProteinModelPortaliQ00731
SMRiQ00731
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204512, 2 interactors
ComplexPortaliCPX-3160 Vascular endothelial growth factor A complex
DIPiDIP-31909N
IntActiQ00731, 3 interactors
STRINGi10090.ENSMUSP00000115883

PTM databases

PhosphoSitePlusiQ00731

Proteomic databases

MaxQBiQ00731
PaxDbiQ00731
PRIDEiQ00731

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951 [Q00731-3]
ENSMUST00000214739; ENSMUSP00000149539; ENSMUSG00000023951 [Q00731-6]
GeneIDi22339
KEGGimmu:22339
UCSCiuc008crn.4 mouse [Q00731-1]
uc008cro.4 mouse [Q00731-2]
uc008crp.4 mouse [Q00731-3]
uc008crr.3 mouse [Q00731-5]

Organism-specific databases

CTDi7422
MGIiMGI:103178 Vegfa

Phylogenomic databases

eggNOGiENOG410IGCM Eukaryota
ENOG410ZWYU LUCA
GeneTreeiENSGT00730000110791
HOGENOMiHOG000230896
HOVERGENiHBG000105
InParanoidiQ00731
KOiK05448
PhylomeDBiQ00731

Enzyme and pathway databases

ReactomeiR-MMU-114608 Platelet degranulation
R-MMU-194313 VEGF ligand-receptor interactions
R-MMU-195399 VEGF binds to VEGFR leading to receptor dimerization
R-MMU-3928662 EPHB-mediated forward signaling
R-MMU-4420097 VEGFA-VEGFR2 Pathway
R-MMU-5218921 VEGFR2 mediated cell proliferation

Miscellaneous databases

ChiTaRSiVegfa mouse
PROiPR:Q00731
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000023951 Expressed in 307 organ(s), highest expression level in lung
CleanExiMM_VEGFA
ExpressionAtlasiQ00731 baseline and differential
GenevisibleiQ00731 MM

Family and domain databases

CDDicd00135 PDGF, 1 hit
Gene3Di2.10.160.10, 1 hit
2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR023581 PD_growth_factor_CS
IPR000072 PDGF/VEGF_dom
IPR027928 VEGF_C
IPR036841 VEGF_C_sf
PfamiView protein in Pfam
PF00341 PDGF, 1 hit
PF14554 VEGF_C, 1 hit
SMARTiView protein in SMART
SM00141 PDGF, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit
SSF57593 SSF57593, 1 hit
PROSITEiView protein in PROSITE
PS00249 PDGF_1, 1 hit
PS50278 PDGF_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiVEGFA_MOUSE
AccessioniPrimary (citable) accession number: Q00731
Secondary accession number(s): O70123
, Q66S31, Q6GT23, Q6WZL9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: September 12, 2018
This is version 176 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again