Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GA-binding protein subunit beta-1

Gene

Gabpb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription factor capable of interacting with purine rich repeats (GA repeats).

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-2151201 Transcriptional activation of mitochondrial biogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
GA-binding protein subunit beta-1
Short name:
GABP subunit beta-1
Short name:
GABPB-1
Alternative name(s):
GABP subunit beta-2
Short name:
GABPB-2
Gene namesi
Name:Gabpb1
Synonyms:Gabpb, Gabpb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:95611 Gabpb1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000669942 – 383GA-binding protein subunit beta-1Add BLAST382

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ00420
PaxDbiQ00420
PeptideAtlasiQ00420
PRIDEiQ00420

PTM databases

iPTMnetiQ00420
PhosphoSitePlusiQ00420

Expressioni

Gene expression databases

BgeeiENSMUSG00000027361 Expressed in 270 organ(s), highest expression level in thymus
CleanExiMM_GABPB1
MM_GABPB2
ExpressionAtlasiQ00420 baseline and differential
GenevisibleiQ00420 MM

Interactioni

Subunit structurei

Interacts with HCFC1, causing repression of transcriptional activity (By similarity). Heterotetramer of two alpha and two beta subunits.By similarity

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-321N
IntActiQ00420, 1 interactor
MINTiQ00420
STRINGi10090.ENSMUSP00000099517

Structurei

Secondary structure

1383
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ00420
SMRiQ00420
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ00420

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati5 – 34ANK 1Add BLAST30
Repeati37 – 66ANK 2Add BLAST30
Repeati70 – 99ANK 3Add BLAST30
Repeati103 – 132ANK 4Add BLAST30
Repeati136 – 166ANK 5Add BLAST31

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IE1V Eukaryota
COG0666 LUCA
GeneTreeiENSGT00910000144124
HOVERGENiHBG051686
InParanoidiQ00420
KOiK09454
OMAiQNTELML
OrthoDBiEOG091G0AIM
PhylomeDBiQ00420
TreeFamiTF326036

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q00420-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLVDLGKKL LEAARAGQDD EVRILMANGA PFTTDWLGTS PLHLAAQYGH
60 70 80 90 100
FSTTEVLLRA GVSRDARTKV DRTPLHMAAS EGHANIVEVL LKHGADVNAK
110 120 130 140 150
DMLKMTALHW ATEHNHQEVV ELLIKYGADV HTQSKFCKTA FDISIDNGNE
160 170 180 190 200
DLAEILQIAM QNQINTNPES PDTVTIHAAT PQFIIGPGGV VNLTDETGVS
210 220 230 240 250
AVQFGNSSTS VLATLAALAE ASAPLSNSSE TPVVATEEVV TAESVDGAIQ
260 270 280 290 300
QVVSSGGQQV ITIVTDGIQL GNLHSIPTSG MGQPIIVTMP DGQQVLTVPA
310 320 330 340 350
TDIAEETVIS EEPPAKRQCM EIIESRVECA EIEEREALQK QLDEANREAQ
360 370 380
KYRQQLLKKE QEAEAYRQKL EAMTRIQTNK EAV
Length:383
Mass (Da):41,358
Last modified:September 19, 2002 - v2
Checksum:iE3BCE5A05B1AF5A9
GO
Isoform 2 (identifier: Q00420-2) [UniParc]FASTAAdd to basket
Also known as: GABP-beta-2 subunit, GABBP2

The sequence of this isoform differs from the canonical sequence as follows:
     334-383: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV → VRSLIPGVFCCSHPK

Show »
Length:348
Mass (Da):36,967
Checksum:i959E2B8504F1292D
GO
Isoform 3 (identifier: Q00420-3) [UniParc]FASTAAdd to basket
Also known as: GABP-beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: Missing.

Note: May be due to competing acceptor splice sites.
Show »
Length:382
Mass (Da):41,258
Checksum:i0A5FE3F71D4227AF
GO
Isoform 4 (identifier: Q00420-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: V → G
     234-383: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:233
Mass (Da):24,803
Checksum:i4E7D67CF5B2D8250
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UT69Q3UT69_MOUSE
GA-binding protein subunit beta-1
Gabpb1
347Annotation score:
A2AQ71A2AQ71_MOUSE
GA-binding protein subunit beta-1
Gabpb1
72Annotation score:
A2AQ72A2AQ72_MOUSE
GA-binding protein subunit beta-1
Gabpb1
46Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009333233Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_009334233V → G in isoform 4. 1 Publication1
Alternative sequenceiVSP_009335234 – 383Missing in isoform 4. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_009336334 – 383EREAL…NKEAV → VRSLIPGVFCCSHPK in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA Translation: AAA53031.1
M74517 mRNA Translation: AAA53032.1
AK040722 mRNA Translation: BAC30682.1
AK052828 mRNA Translation: BAC35165.1
AL844555 Genomic DNA No translation available.
BC013558 mRNA Translation: AAH13558.1
CCDSiCCDS16685.1 [Q00420-3]
CCDS16686.1 [Q00420-2]
CCDS71135.1 [Q00420-4]
CCDS71137.1 [Q00420-1]
PIRiB40858
C40858
RefSeqiNP_001258396.1, NM_001271467.1 [Q00420-3]
NP_001258397.1, NM_001271468.1 [Q00420-1]
NP_001258421.1, NM_001271492.1 [Q00420-4]
NP_034379.1, NM_010249.2 [Q00420-2]
NP_997552.1, NM_207669.2 [Q00420-3]
XP_006498820.1, XM_006498757.3 [Q00420-1]
XP_006498821.1, XM_006498758.3 [Q00420-1]
XP_006498822.1, XM_006498759.3 [Q00420-1]
XP_006498823.1, XM_006498760.3 [Q00420-1]
XP_006498824.1, XM_006498761.3 [Q00420-3]
UniGeneiMm.293266

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361 [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361 [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361 [Q00420-1]
GeneIDi14391
KEGGimmu:14391
UCSCiuc008mdv.2 mouse [Q00420-1]
uc008mdx.2 mouse [Q00420-2]
uc008mdz.2 mouse [Q00420-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA Translation: AAA53031.1
M74517 mRNA Translation: AAA53032.1
AK040722 mRNA Translation: BAC30682.1
AK052828 mRNA Translation: BAC35165.1
AL844555 Genomic DNA No translation available.
BC013558 mRNA Translation: AAH13558.1
CCDSiCCDS16685.1 [Q00420-3]
CCDS16686.1 [Q00420-2]
CCDS71135.1 [Q00420-4]
CCDS71137.1 [Q00420-1]
PIRiB40858
C40858
RefSeqiNP_001258396.1, NM_001271467.1 [Q00420-3]
NP_001258397.1, NM_001271468.1 [Q00420-1]
NP_001258421.1, NM_001271492.1 [Q00420-4]
NP_034379.1, NM_010249.2 [Q00420-2]
NP_997552.1, NM_207669.2 [Q00420-3]
XP_006498820.1, XM_006498757.3 [Q00420-1]
XP_006498821.1, XM_006498758.3 [Q00420-1]
XP_006498822.1, XM_006498759.3 [Q00420-1]
XP_006498823.1, XM_006498760.3 [Q00420-1]
XP_006498824.1, XM_006498761.3 [Q00420-3]
UniGeneiMm.293266

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AWCX-ray2.15B5-157[»]
ProteinModelPortaliQ00420
SMRiQ00420
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-321N
IntActiQ00420, 1 interactor
MINTiQ00420
STRINGi10090.ENSMUSP00000099517

PTM databases

iPTMnetiQ00420
PhosphoSitePlusiQ00420

Proteomic databases

MaxQBiQ00420
PaxDbiQ00420
PeptideAtlasiQ00420
PRIDEiQ00420

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361 [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361 [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361 [Q00420-1]
GeneIDi14391
KEGGimmu:14391
UCSCiuc008mdv.2 mouse [Q00420-1]
uc008mdx.2 mouse [Q00420-2]
uc008mdz.2 mouse [Q00420-4]

Organism-specific databases

CTDi2553
MGIiMGI:95611 Gabpb1

Phylogenomic databases

eggNOGiENOG410IE1V Eukaryota
COG0666 LUCA
GeneTreeiENSGT00910000144124
HOVERGENiHBG051686
InParanoidiQ00420
KOiK09454
OMAiQNTELML
OrthoDBiEOG091G0AIM
PhylomeDBiQ00420
TreeFamiTF326036

Enzyme and pathway databases

ReactomeiR-MMU-2151201 Transcriptional activation of mitochondrial biogenesis

Miscellaneous databases

EvolutionaryTraceiQ00420
PROiPR:Q00420
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027361 Expressed in 270 organ(s), highest expression level in thymus
CleanExiMM_GABPB1
MM_GABPB2
ExpressionAtlasiQ00420 baseline and differential
GenevisibleiQ00420 MM

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiGABP1_MOUSE
AccessioniPrimary (citable) accession number: Q00420
Secondary accession number(s): A2AQ68
, A2AQ70, Q00421, Q8BS31, Q91YZ0, Q9QVV2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: September 19, 2002
Last modified: November 7, 2018
This is version 184 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again