Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 197 (02 Dec 2020)
Sequence version 2 (19 Sep 2002)
Previous versions | rss
Add a publicationFeedback
Protein

GA-binding protein subunit beta-1

Gene

Gabpb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor capable of interacting with purine rich repeats (GA repeats) (PubMed:25200183). Acts as a a master regulator of nuclear-encoded mitochondrial genes (PubMed:25200183).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2151201, Transcriptional activation of mitochondrial biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GA-binding protein subunit beta-1
Short name:
GABP subunit beta-1
Short name:
GABPB-1
Alternative name(s):
GABP subunit beta-2
Short name:
GABPB-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Gabpb1
Synonyms:Gabpb, Gabpb2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:95611, Gabpb1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi69K → R: Decreased acetylation; when associated with R-340 and Lys-369. 1 Publication1
Mutagenesisi340K → R: Decreased acetylation; when associated with R-69 and Lys-369. 1 Publication1
Mutagenesisi369K → R: Decreased acetylation; when associated with R-69 and Lys-340. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000669942 – 383GA-binding protein subunit beta-1Add BLAST382

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei69N6-acetyllysine1 Publication1
Modified residuei340N6-acetyllysine1 Publication1
Modified residuei369N6-acetyllysine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated by EP300/p300 (PubMed:25200183). Deacetylated by SIRT7, promoting heterotetramerization and activity (PubMed:25200183).1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q00420

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q00420

PeptideAtlas

More...
PeptideAtlasi
Q00420

PRoteomics IDEntifications database

More...
PRIDEi
Q00420

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q00420

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q00420

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027361, Expressed in hindlimb bud and 287 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q00420, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q00420, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer of two alpha and two beta subunits (PubMed:25200183).

Interacts with HCFC1, causing repression of transcriptional activity (By similarity).

By similarity1 Publication

Protein-protein interaction databases

Database of interacting proteins

More...
DIPi
DIP-321N

Protein interaction database and analysis system

More...
IntActi
Q00420, 1 interactor

Molecular INTeraction database

More...
MINTi
Q00420

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106055

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q00420, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1383
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q00420

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q00420

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati5 – 34ANK 1Add BLAST30
Repeati37 – 66ANK 2Add BLAST30
Repeati70 – 99ANK 3Add BLAST30
Repeati103 – 132ANK 4Add BLAST30
Repeati136 – 166ANK 5Add BLAST31

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRTX, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157875

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000134_12_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q00420

Identification of Orthologs from Complete Genome Data

More...
OMAi
PXEREAL

Database of Orthologous Groups

More...
OrthoDBi
1514706at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q00420

TreeFam database of animal gene trees

More...
TreeFami
TF326036

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796, Ank_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415, ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248, ANK, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403, SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q00420-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLVDLGKKL LEAARAGQDD EVRILMANGA PFTTDWLGTS PLHLAAQYGH
60 70 80 90 100
FSTTEVLLRA GVSRDARTKV DRTPLHMAAS EGHANIVEVL LKHGADVNAK
110 120 130 140 150
DMLKMTALHW ATEHNHQEVV ELLIKYGADV HTQSKFCKTA FDISIDNGNE
160 170 180 190 200
DLAEILQIAM QNQINTNPES PDTVTIHAAT PQFIIGPGGV VNLTDETGVS
210 220 230 240 250
AVQFGNSSTS VLATLAALAE ASAPLSNSSE TPVVATEEVV TAESVDGAIQ
260 270 280 290 300
QVVSSGGQQV ITIVTDGIQL GNLHSIPTSG MGQPIIVTMP DGQQVLTVPA
310 320 330 340 350
TDIAEETVIS EEPPAKRQCM EIIESRVECA EIEEREALQK QLDEANREAQ
360 370 380
KYRQQLLKKE QEAEAYRQKL EAMTRIQTNK EAV
Length:383
Mass (Da):41,358
Last modified:September 19, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE3BCE5A05B1AF5A9
GO
Isoform 2 (identifier: Q00420-2) [UniParc]FASTAAdd to basket
Also known as: GABP-beta-2 subunit, GABBP2

The sequence of this isoform differs from the canonical sequence as follows:
     334-383: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV → VRSLIPGVFCCSHPK

Show »
Length:348
Mass (Da):36,967
Checksum:i959E2B8504F1292D
GO
Isoform 3 (identifier: Q00420-3) [UniParc]FASTAAdd to basket
Also known as: GABP-beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: Missing.

Note: May be due to competing acceptor splice sites.Curated
Show »
Length:382
Mass (Da):41,258
Checksum:i0A5FE3F71D4227AF
GO
Isoform 4 (identifier: Q00420-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: V → G
     234-383: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:233
Mass (Da):24,803
Checksum:i4E7D67CF5B2D8250
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UT69Q3UT69_MOUSE
GA-binding protein subunit beta-1
Gabpb1
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AQ71A2AQ71_MOUSE
GA-binding protein subunit beta-1
Gabpb1
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AQ72A2AQ72_MOUSE
GA-binding protein subunit beta-1
Gabpb1
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_009333233Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_009334233V → G in isoform 4. 1 Publication1
Alternative sequenceiVSP_009335234 – 383Missing in isoform 4. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_009336334 – 383EREAL…NKEAV → VRSLIPGVFCCSHPK in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M74516 mRNA Translation: AAA53031.1
M74517 mRNA Translation: AAA53032.1
AK040722 mRNA Translation: BAC30682.1
AK052828 mRNA Translation: BAC35165.1
AL844555 Genomic DNA No translation available.
BC013558 mRNA Translation: AAH13558.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16685.1 [Q00420-3]
CCDS16686.1 [Q00420-2]
CCDS71135.1 [Q00420-4]
CCDS71137.1 [Q00420-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
B40858
C40858

NCBI Reference Sequences

More...
RefSeqi
NP_001258396.1, NM_001271467.1 [Q00420-3]
NP_001258397.1, NM_001271468.1 [Q00420-1]
NP_001258421.1, NM_001271492.1 [Q00420-4]
NP_034379.1, NM_010249.2 [Q00420-2]
NP_997552.1, NM_207669.2 [Q00420-3]
XP_006498820.1, XM_006498757.3 [Q00420-1]
XP_006498821.1, XM_006498758.3
XP_006498822.1, XM_006498759.3 [Q00420-1]
XP_006498823.1, XM_006498760.3 [Q00420-1]
XP_006498824.1, XM_006498761.3 [Q00420-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361 [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361 [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361 [Q00420-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14391

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14391

UCSC genome browser

More...
UCSCi
uc008mdv.2, mouse [Q00420-1]
uc008mdx.2, mouse [Q00420-2]
uc008mdz.2, mouse [Q00420-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA Translation: AAA53031.1
M74517 mRNA Translation: AAA53032.1
AK040722 mRNA Translation: BAC30682.1
AK052828 mRNA Translation: BAC35165.1
AL844555 Genomic DNA No translation available.
BC013558 mRNA Translation: AAH13558.1
CCDSiCCDS16685.1 [Q00420-3]
CCDS16686.1 [Q00420-2]
CCDS71135.1 [Q00420-4]
CCDS71137.1 [Q00420-1]
PIRiB40858
C40858
RefSeqiNP_001258396.1, NM_001271467.1 [Q00420-3]
NP_001258397.1, NM_001271468.1 [Q00420-1]
NP_001258421.1, NM_001271492.1 [Q00420-4]
NP_034379.1, NM_010249.2 [Q00420-2]
NP_997552.1, NM_207669.2 [Q00420-3]
XP_006498820.1, XM_006498757.3 [Q00420-1]
XP_006498821.1, XM_006498758.3
XP_006498822.1, XM_006498759.3 [Q00420-1]
XP_006498823.1, XM_006498760.3 [Q00420-1]
XP_006498824.1, XM_006498761.3 [Q00420-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AWCX-ray2.15B5-157[»]
SMRiQ00420
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

DIPiDIP-321N
IntActiQ00420, 1 interactor
MINTiQ00420
STRINGi10090.ENSMUSP00000106055

PTM databases

iPTMnetiQ00420
PhosphoSitePlusiQ00420

Proteomic databases

MaxQBiQ00420
PaxDbiQ00420
PeptideAtlasiQ00420
PRIDEiQ00420

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1425, 319 antibodies

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361 [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361 [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361 [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361 [Q00420-1]
GeneIDi14391
KEGGimmu:14391
UCSCiuc008mdv.2, mouse [Q00420-1]
uc008mdx.2, mouse [Q00420-2]
uc008mdz.2, mouse [Q00420-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2553
MGIiMGI:95611, Gabpb1

Phylogenomic databases

eggNOGiENOG502QRTX, Eukaryota
GeneTreeiENSGT00940000157875
HOGENOMiCLU_000134_12_0_1
InParanoidiQ00420
OMAiPXEREAL
OrthoDBi1514706at2759
PhylomeDBiQ00420
TreeFamiTF326036

Enzyme and pathway databases

ReactomeiR-MMU-2151201, Transcriptional activation of mitochondrial biogenesis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
14391, 9 hits in 20 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Gabpb1, mouse
EvolutionaryTraceiQ00420

Protein Ontology

More...
PROi
PR:Q00420
RNActiQ00420, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027361, Expressed in hindlimb bud and 287 other tissues
ExpressionAtlasiQ00420, baseline and differential
GenevisibleiQ00420, MM

Family and domain databases

Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796, Ank_2, 1 hit
PRINTSiPR01415, ANKYRIN
SMARTiView protein in SMART
SM00248, ANK, 4 hits
SUPFAMiSSF48403, SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGABP1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q00420
Secondary accession number(s): A2AQ68
, A2AQ70, Q00421, Q8BS31, Q91YZ0, Q9QVV2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: September 19, 2002
Last modified: December 2, 2020
This is version 197 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again