Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q00013 (EM55_HUMAN)

Entry version 208 (10 Feb 2021)
Sequence version 2 (01 Feb 1996)
Previous versions | rss
Add a publicationFeedback
Protein

55 kDa erythrocyte membrane protein

Gene

MPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity (By similarity).By similarity

Caution

Thought to be palmitoylated by ZDHHC17 (PubMed:22496366). This work was later retracted due to image manipulation (PubMed:29475958).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q00013

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
55 kDa erythrocyte membrane protein
Short name:
p55
Alternative name(s):
Membrane protein, palmitoylated 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPP1
Synonyms:DXS552E, EMP55
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7219, MPP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		305360, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q00013

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000130830.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		4354

Open Targets

More...OpenTargetsi		ENSG00000130830

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30924

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q00013, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MPP1

Domain mapping of disease mutations (DMDM)

More...DMDMi		1346575

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945652 – 46655 kDa erythrocyte membrane proteinAdd BLAST465

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonineCombined sources1
Modified residuei13PhosphoserineCombined sources1
Modified residuei19PhosphoserineCombined sources1
Modified residuei49PhosphothreonineCombined sources1
Modified residuei52PhosphoserineBy similarity1
Modified residuei57PhosphoserineCombined sources1
Modified residuei110PhosphoserineCombined sources1
Modified residuei243PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated.1 Publication

Keywords - PTMi

Acetylation, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q00013

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q00013

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q00013

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q00013

PeptideAtlas

More...PeptideAtlasi		Q00013

PRoteomics IDEntifications database

More...PRIDEi		Q00013

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		33755
57837 [Q00013-1]
57838 [Q00013-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q00013

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q00013

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q00013

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q00013

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000130830, Expressed in blood and 245 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q00013, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q00013, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000130830, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with MPP5.

Interacts with DLG5 and NF2.

Interacts (via guanylate kinase-like domain) with WHRN (via third PDZ domain).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110494, 79 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q00013

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q00013

Protein interaction database and analysis system

More...IntActi		Q00013, 69 interactors

Molecular INTeraction database

More...MINTi		Q00013

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000358547

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q00013, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1466
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q00013

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q00013

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini71 – 152PDZPROSITE-ProRule annotationAdd BLAST82
Domaini158 – 228SH3PROSITE-ProRule annotationAdd BLAST71
Domaini282 – 451Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST170

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni268 – 466Interaction with MPP51 PublicationAdd BLAST199

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0609, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158744

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001715_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q00013

Identification of Orthologs from Complete Genome Data

More...OMAi		AMTEDIY

Database of Orthologous Groups

More...OrthoDBi		95102at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q00013

TreeFam database of animal gene trees

More...TreeFami		TF314263

Family and domain databases

Conserved Domains Database

More...CDDi		cd12080, SH3_MPP1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008145, GK/Ca_channel_bsu
IPR008144, Guanylate_kin-like_dom
IPR020590, Guanylate_kinase_CS
IPR035475, MPP1_SH3
IPR027417, P-loop_NTPase
IPR001478, PDZ
IPR036034, PDZ_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF00595, PDZ, 1 hit
PF00018, SH3_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00072, GuKc, 1 hit
SM00228, PDZ, 1 hit
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044, SSF50044, 1 hit
SSF50156, SSF50156, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00856, GUANYLATE_KINASE_1, 1 hit
PS50052, GUANYLATE_KINASE_2, 1 hit
PS50106, PDZ, 1 hit
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q00013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTLKASEGES GGSMHTALSD LYLEHLLQKR SRPEAVSHPL NTVTEDMYTN 
        60         70         80         90        100
GSPAPGSPAQ VKGQEVRKVR LIQFEKVTEE PMGITLKLNE KQSCTVARIL 
       110        120        130        140        150
HGGMIHRQGS LHVGDEILEI NGTNVTNHSV DQLQKAMKET KGMISLKVIP 
       160        170        180        190        200
NQQSRLPALQ MFMRAQFDYD PKKDNLIPCK EAGLKFATGD IIQIINKDDS 
       210        220        230        240        250
NWWQGRVEGS SKESAGLIPS PELQEWRVAS MAQSAPSEAP SCSPFGKKKK 
       260        270        280        290        300
YKDKYLAKHS SIFDQLDVVS YEEVVRLPAF KRKTLVLIGA SGVGRSHIKN 
       310        320        330        340        350
ALLSQNPEKF VYPVPYTTRP PRKSEEDGKE YHFISTEEMT RNISANEFLE 
       360        370        380        390        400
FGSYQGNMFG TKFETVHQIH KQNKIAILDI EPQTLKIVRT AELSPFIVFI 
       410        420        430        440        450
APTDQGTQTE ALQQLQKDSE AIRSQYAHYF DLSLVNNGVD ETLKKLQEAF 
       460 
DQACSSPQWV PVSWVY
Length:466
Mass (Da):52,296
Last modified:February 1, 1996 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC68AA68EF48A26E
GO
Isoform 2 (identifier: Q00013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPE → MESW

Show »
Length:436
Mass (Da):49,075
Checksum:iD70881879A5C497A
GO
Isoform 3 (identifier: Q00013-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-180: Missing.

Show »
Length:446
Mass (Da):49,854
Checksum:iC935FBFA6E563CE1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MTH1A8MTH1_HUMAN
55 kDa erythrocyte membrane protein
MPP1
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6NFY0A6NFY0_HUMAN
55 kDa erythrocyte membrane protein
MPP1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JB34C9JB34_HUMAN
55 kDa erythrocyte membrane protein
MPP1
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J9J4C9J9J4_HUMAN
55 kDa erythrocyte membrane protein
MPP1
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC84F8WC84_HUMAN
55 kDa erythrocyte membrane protein
MPP1
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDV6F8WDV6_HUMAN
55 kDa erythrocyte membrane protein
MPP1
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti204Q → R in AAV35469 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_011914448E → Q. Corresponds to variant dbSNP:rs14092Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0426751 – 34MTLKA…RSRPE → MESW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_044634161 – 180Missing in isoform 3. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M64925 mRNA Translation: AAA60059.1
M87059 Genomic DNA Translation: AAA60060.1
U39611 Genomic DNA Translation: AAD14835.1
AY423731 mRNA Translation: AAS00494.1
AK290246 mRNA Translation: BAF82935.1
AK303111 mRNA Translation: BAG64217.1
AK312296 mRNA Translation: BAG35223.1
AK315957 mRNA Translation: BAH14328.1
AY634686 mRNA Translation: AAV35469.1
AC109993 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72655.1
CH471172 Genomic DNA Translation: EAW72656.1
CH471172 Genomic DNA Translation: EAW72660.1
BC002392 mRNA Translation: AAH02392.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14762.1 [Q00013-1]
CCDS55544.1 [Q00013-2]
CCDS55545.1 [Q00013-3]

Protein sequence database of the Protein Information Resource

More...PIRi		A39599

NCBI Reference Sequences

More...RefSeqi		NP_001159932.1, NM_001166460.1
NP_001159933.1, NM_001166461.1 [Q00013-3]
NP_001159934.1, NM_001166462.1 [Q00013-2]
NP_002427.1, NM_002436.3 [Q00013-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000369534; ENSP00000358547; ENSG00000130830 [Q00013-1]
ENST00000393531; ENSP00000377165; ENSG00000130830 [Q00013-3]
ENST00000413259; ENSP00000400155; ENSG00000130830 [Q00013-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4354

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4354

UCSC genome browser

More...UCSCi		uc004fmp.3, human [Q00013-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64925 mRNA Translation: AAA60059.1
M87059 Genomic DNA Translation: AAA60060.1
U39611 Genomic DNA Translation: AAD14835.1
AY423731 mRNA Translation: AAS00494.1
AK290246 mRNA Translation: BAF82935.1
AK303111 mRNA Translation: BAG64217.1
AK312296 mRNA Translation: BAG35223.1
AK315957 mRNA Translation: BAH14328.1
AY634686 mRNA Translation: AAV35469.1
AC109993 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72655.1
CH471172 Genomic DNA Translation: EAW72656.1
CH471172 Genomic DNA Translation: EAW72660.1
BC002392 mRNA Translation: AAH02392.1
CCDSiCCDS14762.1 [Q00013-1]
CCDS55544.1 [Q00013-2]
CCDS55545.1 [Q00013-3]
PIRiA39599
RefSeqiNP_001159932.1, NM_001166460.1
NP_001159933.1, NM_001166461.1 [Q00013-3]
NP_001159934.1, NM_001166462.1 [Q00013-2]
NP_002427.1, NM_002436.3 [Q00013-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EJYNMR-A69-153[»]
2EV8NMR-A69-153[»]
3NEYX-ray2.26A/B/C/D/E/F282-460[»]
SMRiQ00013
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110494, 79 interactors
CORUMiQ00013
ELMiQ00013
IntActiQ00013, 69 interactors
MINTiQ00013
STRINGi9606.ENSP00000358547

PTM databases

iPTMnetiQ00013
MetOSiteiQ00013
PhosphoSitePlusiQ00013
SwissPalmiQ00013

Genetic variation databases

BioMutaiMPP1
DMDMi1346575

Proteomic databases

EPDiQ00013
jPOSTiQ00013
MassIVEiQ00013
PaxDbiQ00013
PeptideAtlasiQ00013
PRIDEiQ00013
ProteomicsDBi33755
57837 [Q00013-1]
57838 [Q00013-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		419, 326 antibodies

The DNASU plasmid repository

More...DNASUi		4354

Genome annotation databases

EnsembliENST00000369534; ENSP00000358547; ENSG00000130830 [Q00013-1]
ENST00000393531; ENSP00000377165; ENSG00000130830 [Q00013-3]
ENST00000413259; ENSP00000400155; ENSG00000130830 [Q00013-2]
GeneIDi4354
KEGGihsa:4354
UCSCiuc004fmp.3, human [Q00013-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4354
DisGeNETi4354

GeneCards: human genes, protein and diseases

More...GeneCardsi		MPP1
HGNCiHGNC:7219, MPP1
HPAiENSG00000130830, Low tissue specificity
MIMi305360, gene
neXtProtiNX_Q00013
OpenTargetsiENSG00000130830
PharmGKBiPA30924
VEuPathDBiHostDB:ENSG00000130830.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0609, Eukaryota
GeneTreeiENSGT00940000158744
HOGENOMiCLU_001715_5_1_1
InParanoidiQ00013
OMAiAMTEDIY
OrthoDBi95102at2759
PhylomeDBiQ00013
TreeFamiTF314263

Enzyme and pathway databases

PathwayCommonsiQ00013

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4354, 2 hits in 499 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MPP1, human
EvolutionaryTraceiQ00013

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MPP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4354
PharosiQ00013, Tbio

Protein Ontology

More...PROi		PR:Q00013
RNActiQ00013, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000130830, Expressed in blood and 245 other tissues
ExpressionAtlasiQ00013, baseline and differential
GenevisibleiQ00013, HS

Family and domain databases

CDDicd12080, SH3_MPP1, 1 hit
Gene3Di2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR008145, GK/Ca_channel_bsu
IPR008144, Guanylate_kin-like_dom
IPR020590, Guanylate_kinase_CS
IPR035475, MPP1_SH3
IPR027417, P-loop_NTPase
IPR001478, PDZ
IPR036034, PDZ_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
PfamiView protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF00595, PDZ, 1 hit
PF00018, SH3_1, 1 hit
SMARTiView protein in SMART
SM00072, GuKc, 1 hit
SM00228, PDZ, 1 hit
SM00326, SH3, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF50156, SSF50156, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856, GUANYLATE_KINASE_1, 1 hit
PS50052, GUANYLATE_KINASE_2, 1 hit
PS50106, PDZ, 1 hit
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEM55_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q00013
Secondary accession number(s): B4DZV5
, G3XAI1, Q2TSB6, Q5J7V5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: February 1, 1996
Last modified: February 10, 2021
This is version 208 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  6. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again