Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q00005 (2ABB_HUMAN)

Entry version 203 (10 Feb 2021)
Sequence version 1 (01 Apr 1993)
Previous versions | rss
Add a publicationFeedback
Protein

Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform

Gene

PPP2R2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is required to promote proapoptotic activity (By similarity). Isoform 2 regulates neuronal survival through the mitochondrial fission and fusion balance (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q00005

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q00005

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q00005

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
Alternative name(s):
PP2A subunit B isoform B55-beta
PP2A subunit B isoform PR55-beta
PP2A subunit B isoform R2-beta
PP2A subunit B isoform beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP2R2B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9305, PPP2R2B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604325, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q00005

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000156475.18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Spinocerebellar ataxia 12 (SCA12)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionSpinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA12 is an autosomal dominant cerebellar ataxia (ADCA).
Related information in OMIM

Keywords - Diseasei

Disease variant, Neurodegeneration, Spinocerebellar ataxia

Organism-specific databases

DisGeNET

More...DisGeNETi		5521

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		PPP2R2B

MalaCards human disease database

More...MalaCardsi		PPP2R2B
MIMi604326, phenotype

Open Targets

More...OpenTargetsi		ENSG00000156475

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		98762, Spinocerebellar ataxia type 12

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33669

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q00005, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PPP2R2B

Domain mapping of disease mutations (DMDM)

More...DMDMi		231446

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000714211 – 443Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoformAdd BLAST443

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei275PhosphoserineBy similarity1
Modified residuei295PhosphotyrosineBy similarity1
Modified residuei298PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q00005

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q00005

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q00005

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q00005

PeptideAtlas

More...PeptideAtlasi		Q00005

PRoteomics IDEntifications database

More...PRIDEi		Q00005

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		32258
57832
57833 [Q00005-2]
57834 [Q00005-3]
57835 [Q00005-4]
57836 [Q00005-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q00005

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q00005

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000156475, Expressed in corpus callosum and 208 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q00005, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q00005, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000156475, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules (By similarity).

Interacts with TOMM22 (By similarity).

Interacts with IER5 (via N- and C-terminal regions) (PubMed:25816751, PubMed:26496226).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111513, 64 interactors

Protein interaction database and analysis system

More...IntActi		Q00005, 181 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000377936

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q00005, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q00005

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati22 – 61WD 1Add BLAST40
Repeati87 – 128WD 2Add BLAST42
Repeati171 – 209WD 3Add BLAST39
Repeati220 – 260WD 4Add BLAST41
Repeati279 – 317WD 5Add BLAST39
Repeati334 – 375WD 6Add BLAST42
Repeati410 – 442WD 7Add BLAST33

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal 26 residues of isoform 2 constitute a cryptic mitochondrial matrix import signal with critical basic and hydrophobic residues, that is necessary and sufficient for targeting the PP2A holoenzyme to the outer mitochondrial membrane (OMM) and does not affect holoenzyme formation or catalytic activity.By similarity
The last WD repeat of isoform 2 constitutes a mitochondrial stop-transfer domain that confers resistance to the unfolding step process required for import and therefore prevents PPP2R2B matrix translocation and signal sequence cleavage.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the phosphatase 2A regulatory subunit B family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1354, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182864

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021713_3_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q00005

Identification of Orthologs from Complete Genome Data

More...OMAi		RRKNQSH

Database of Orthologous Groups

More...OrthoDBi		810409at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q00005

TreeFam database of animal gene trees

More...TreeFami		TF105553

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000009, PP2A_PR55
IPR018067, PP2A_PR55_CS
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR036322, WD40_repeat_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR11871, PTHR11871, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF037309, PP2A_PR55, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00600, PP2APR55

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320, WD40, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50978, SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01024, PR55_1, 1 hit
PS01025, PR55_2, 1 hit
PS00678, WD_REPEATS_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q00005-1) [UniParc]FASTAAdd to basket
Also known as: Bbeta, Bbeta1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEDIDTRKI NNSFLRDHSY ATEADIISTV EFNHTGELLA TGDKGGRVVI 
        60         70         80         90        100
FQREQESKNQ VHRRGEYNVY STFQSHEPEF DYLKSLEIEE KINKIRWLPQ 
       110        120        130        140        150
QNAAYFLLST NDKTVKLWKV SERDKRPEGY NLKDEEGRLR DPATITTLRV 
       160        170        180        190        200
PVLRPMDLMV EATPRRVFAN AHTYHINSIS VNSDYETYMS ADDLRINLWN 
       210        220        230        240        250
FEITNQSFNI VDIKPANMEE LTEVITAAEF HPHHCNTFVY SSSKGTIRLC 
       260        270        280        290        300
DMRASALCDR HTKFFEEPED PSNRSFFSEI ISSISDVKFS HSGRYIMTRD 
       310        320        330        340        350
YLTVKVWDLN MENRPIETYQ VHDYLRSKLC SLYENDCIFD KFECVWNGSD 
       360        370        380        390        400
SVIMTGSYNN FFRMFDRNTK RDVTLEASRE NSKPRAILKP RKVCVGGKRR 
       410        420        430        440 
KDEISVDSLD FSKKILHTAW HPSENIIAVA ATNNLYIFQD KVN
Note: Conserved additional ATG codons are found 5' of the putative initiator codon in transcripts supporting isoform 1. They may initiate the translation of upstream short open reading frames altering the expression of that isoform as described in PubMed:1849734.
Length:443
Mass (Da):51,710
Last modified:April 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC383C834B2852B8F
GO
Isoform 2 (identifier: Q00005-2) [UniParc]FASTAAdd to basket
Also known as: Bbeta2

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MEEDIDTRKINNSFLRDHSYA → MKCFSRYLPYIFRPPNTILSSSCH

Note: Contains a cryptic mitochondrial transit peptide at positions 1-26.By similarity
Show »
Length:446
Mass (Da):52,017
Checksum:iD5BDD8D10F79CF0B
GO
Isoform 3 (identifier: Q00005-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MEEDIDTRKINNSFLRDHSYA → MIPGIGTLTQDTLWCFSQVKGTIEIGT

Show »
Length:449
Mass (Da):52,066
Checksum:i6773D04E733403B1
GO
Isoform 4 (identifier: Q00005-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVLQPSERHYRDWNHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSM

Show »
Length:501
Mass (Da):58,171
Checksum:i3FE3DD278143364A
GO
Isoform 5 (identifier: Q00005-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLSLPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSM

Show »
Length:509
Mass (Da):58,897
Checksum:iD47AFC5DD1629FDB
GO
Isoform 6 (identifier: Q00005-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: MEEDIDTRKINNSFLRDHSYATE → MNYPDENTYGNK

Show »
Length:432
Mass (Da):50,371
Checksum:iB63F511DEF9670CA
GO
Isoform 7 (identifier: Q00005-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHQPPPASCS...VPTQVSLLSM

Show »
Length:549
Mass (Da):62,505
Checksum:iDFACDC3C235450D7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RGF9D6RGF9_HUMAN
Serine/threonine-protein phosphatas...
PPP2R2B
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA16H0YA16_HUMAN
Serine/threonine-protein phosphatas...
PPP2R2B
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PCT7E9PCT7_HUMAN
Serine/threonine-protein phosphatas...
PPP2R2B
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RB57D6RB57_HUMAN
Serine/threonine-protein phosphatas...
PPP2R2B
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RF04D6RF04_HUMAN
Serine/threonine-protein phosphatas...
PPP2R2B
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFC4E5RFC4_HUMAN
Serine/threonine-protein phosphatas...
PPP2R2B
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH31790 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG51642 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG51642 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22T → A in BAH11838 (PubMed:14702039).Curated1
Sequence conflicti62H → N in BI669304 (PubMed:15489334).Curated1
Sequence conflicti109S → F in BAH12040 (PubMed:14702039).Curated1
Sequence conflicti163T → S in BI490027 (Ref. 6) Curated1
Sequence conflicti164P → S in BAF82406 (PubMed:14702039).Curated1
Sequence conflicti292S → R in BAH12040 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05173836G → V. Corresponds to variant dbSNP:rs11547494Ensembl.1
Natural variantiVAR_078654138R → P Probable disease-associated variant found in a patient with moderate intellectual disability, authism and intractable epilepsy. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0449231 – 23MEEDI…SYATE → MNYPDENTYGNK in isoform 6. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0379761 – 21MEEDI…DHSYA → MKCFSRYLPYIFRPPNTILS SSCH in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_0379771 – 21MEEDI…DHSYA → MIPGIGTLTQDTLWCFSQVK GTIEIGT in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_0379781M → MVLQPSERHYRDWNHRRLGP WCSPTGSPAPLSCETGCGEG SWILVCRLLVPTQVSLLSM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0379791M → MLLSLPALHLQTSEHHPFFQ LPHRRLGPWCSPTGSPAPLS CETGCGEGSWILVCRLLVPT QVSLLSM in isoform 5. 1 Publication1
Alternative sequenceiVSP_0457481M → MHQPPPASCSSSSSSSSSSC ECARVGVRVSALAPAAAPCP APRQLPYPRLPEPPSRGTST LIPARLGPWCSPTGSPAPLS CETGCGEGSWILVCRLLVPT QVSLLSM in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M64930 mRNA Translation: AAA36493.1
AK056192 mRNA Translation: BAG51642.1 Sequence problems.
AK289717 mRNA Translation: BAF82406.1
AK294659 mRNA Translation: BAH11838.1
AK295347 mRNA Translation: BAH12040.1
AC008728 Genomic DNA No translation available.
AC009186 Genomic DNA No translation available.
AC010251 Genomic DNA No translation available.
AC011386 Genomic DNA No translation available.
AC011357 Genomic DNA No translation available.
AC091919 Genomic DNA No translation available.
AC091924 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61829.1
CH471062 Genomic DNA Translation: EAW61831.1
CH471062 Genomic DNA Translation: EAW61832.1
CH471062 Genomic DNA Translation: EAW61833.1
CH471062 Genomic DNA Translation: EAW61834.1
CH471062 Genomic DNA Translation: EAW61835.1
BC031790 mRNA Translation: AAH31790.1 Different initiation.
BI490027 mRNA No translation available.
BI669304 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4283.1 [Q00005-2]
CCDS4284.2 [Q00005-5]
CCDS43380.1 [Q00005-6]
CCDS64281.1 [Q00005-4]
CCDS64282.1 [Q00005-3]

Protein sequence database of the Protein Information Resource

More...PIRi		B38351

NCBI Reference Sequences

More...RefSeqi		NP_001258828.1, NM_001271899.1 [Q00005-3]
NP_001258829.1, NM_001271900.1 [Q00005-4]
NP_001258877.1, NM_001271948.1 [Q00005-6]
NP_858060.2, NM_181674.2 [Q00005-5]
NP_858061.2, NM_181675.3 [Q00005-1]
NP_858062.1, NM_181676.2 [Q00005-2]
NP_858063.1, NM_181677.2
NP_858064.1, NM_181678.2 [Q00005-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000336640; ENSP00000336591; ENSG00000156475 [Q00005-2]
ENST00000394409; ENSP00000377931; ENSG00000156475 [Q00005-1]
ENST00000394411; ENSP00000377933; ENSG00000156475 [Q00005-1]
ENST00000394413; ENSP00000377935; ENSG00000156475 [Q00005-4]
ENST00000394414; ENSP00000377936; ENSG00000156475 [Q00005-5]
ENST00000453001; ENSP00000398779; ENSG00000156475 [Q00005-6]
ENST00000504198; ENSP00000421396; ENSG00000156475 [Q00005-3]
ENST00000508545; ENSP00000431320; ENSG00000156475 [Q00005-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5521

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5521

UCSC genome browser

More...UCSCi		uc003loe.6, human [Q00005-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64930 mRNA Translation: AAA36493.1
AK056192 mRNA Translation: BAG51642.1 Sequence problems.
AK289717 mRNA Translation: BAF82406.1
AK294659 mRNA Translation: BAH11838.1
AK295347 mRNA Translation: BAH12040.1
AC008728 Genomic DNA No translation available.
AC009186 Genomic DNA No translation available.
AC010251 Genomic DNA No translation available.
AC011386 Genomic DNA No translation available.
AC011357 Genomic DNA No translation available.
AC091919 Genomic DNA No translation available.
AC091924 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61829.1
CH471062 Genomic DNA Translation: EAW61831.1
CH471062 Genomic DNA Translation: EAW61832.1
CH471062 Genomic DNA Translation: EAW61833.1
CH471062 Genomic DNA Translation: EAW61834.1
CH471062 Genomic DNA Translation: EAW61835.1
BC031790 mRNA Translation: AAH31790.1 Different initiation.
BI490027 mRNA No translation available.
BI669304 mRNA No translation available.
CCDSiCCDS4283.1 [Q00005-2]
CCDS4284.2 [Q00005-5]
CCDS43380.1 [Q00005-6]
CCDS64281.1 [Q00005-4]
CCDS64282.1 [Q00005-3]
PIRiB38351
RefSeqiNP_001258828.1, NM_001271899.1 [Q00005-3]
NP_001258829.1, NM_001271900.1 [Q00005-4]
NP_001258877.1, NM_001271948.1 [Q00005-6]
NP_858060.2, NM_181674.2 [Q00005-5]
NP_858061.2, NM_181675.3 [Q00005-1]
NP_858062.1, NM_181676.2 [Q00005-2]
NP_858063.1, NM_181677.2
NP_858064.1, NM_181678.2 [Q00005-6]

3D structure databases

SMRiQ00005
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi111513, 64 interactors
IntActiQ00005, 181 interactors
STRINGi9606.ENSP00000377936

PTM databases

iPTMnetiQ00005
PhosphoSitePlusiQ00005

Genetic variation databases

BioMutaiPPP2R2B
DMDMi231446

Proteomic databases

jPOSTiQ00005
MassIVEiQ00005
MaxQBiQ00005
PaxDbiQ00005
PeptideAtlasiQ00005
PRIDEiQ00005
ProteomicsDBi32258
57832
57833 [Q00005-2]
57834 [Q00005-3]
57835 [Q00005-4]
57836 [Q00005-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27589, 215 antibodies

The DNASU plasmid repository

More...DNASUi		5521

Genome annotation databases

EnsembliENST00000336640; ENSP00000336591; ENSG00000156475 [Q00005-2]
ENST00000394409; ENSP00000377931; ENSG00000156475 [Q00005-1]
ENST00000394411; ENSP00000377933; ENSG00000156475 [Q00005-1]
ENST00000394413; ENSP00000377935; ENSG00000156475 [Q00005-4]
ENST00000394414; ENSP00000377936; ENSG00000156475 [Q00005-5]
ENST00000453001; ENSP00000398779; ENSG00000156475 [Q00005-6]
ENST00000504198; ENSP00000421396; ENSG00000156475 [Q00005-3]
ENST00000508545; ENSP00000431320; ENSG00000156475 [Q00005-6]
GeneIDi5521
KEGGihsa:5521
UCSCiuc003loe.6, human [Q00005-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5521
DisGeNETi5521

GeneCards: human genes, protein and diseases

More...GeneCardsi		PPP2R2B
GeneReviewsiPPP2R2B
HGNCiHGNC:9305, PPP2R2B
HPAiENSG00000156475, Tissue enriched (brain)
MalaCardsiPPP2R2B
MIMi604325, gene
604326, phenotype
neXtProtiNX_Q00005
OpenTargetsiENSG00000156475
Orphaneti98762, Spinocerebellar ataxia type 12
PharmGKBiPA33669
VEuPathDBiHostDB:ENSG00000156475.18

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1354, Eukaryota
GeneTreeiENSGT00950000182864
HOGENOMiCLU_021713_3_3_1
InParanoidiQ00005
OMAiRRKNQSH
OrthoDBi810409at2759
PhylomeDBiQ00005
TreeFamiTF105553

Enzyme and pathway databases

PathwayCommonsiQ00005
SignaLinkiQ00005
SIGNORiQ00005

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5521, 7 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PPP2R2B, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PPP2R2B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5521
PharosiQ00005, Tbio

Protein Ontology

More...PROi		PR:Q00005
RNActiQ00005, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000156475, Expressed in corpus callosum and 208 other tissues
ExpressionAtlasiQ00005, baseline and differential
GenevisibleiQ00005, HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR000009, PP2A_PR55
IPR018067, PP2A_PR55_CS
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR036322, WD40_repeat_dom_sf
PANTHERiPTHR11871, PTHR11871, 1 hit
PIRSFiPIRSF037309, PP2A_PR55, 1 hit
PRINTSiPR00600, PP2APR55
SMARTiView protein in SMART
SM00320, WD40, 6 hits
SUPFAMiSSF50978, SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS01024, PR55_1, 1 hit
PS01025, PR55_2, 1 hit
PS00678, WD_REPEATS_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei2ABB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q00005
Secondary accession number(s): A6NEJ2
, A8K102, B3KPD0, B7Z2F2, B7Z304, D3DQF7, D3DQF8, G3V149
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: February 10, 2021
This is version 203 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  5. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again