Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid-transporting ATPase ID

Gene

ATP8B2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules (Probable).Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei4114-aspartylphosphate intermediateBy similarity1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi833MagnesiumBy similarity1
Metal bindingi837MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • magnesium ion binding Source: InterPro
  • phospholipid-translocating ATPase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTranslocase
Biological processLipid transport, Transport
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-936837 Ion transport by P-type ATPases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipid-transporting ATPase ID (EC:7.6.2.1)
Alternative name(s):
ATPase class I type 8B member 2
P4-ATPase flippase complex alpha subunit ATP8B2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP8B2
Synonyms:ATPID, KIAA1137
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143515.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13534 ATP8B2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605867 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P98198

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 64CytoplasmicSequence analysisAdd BLAST64
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei65 – 86HelicalSequence analysisAdd BLAST22
Topological domaini87 – 92Exoplasmic loopSequence analysis6
Transmembranei93 – 112HelicalSequence analysisAdd BLAST20
Topological domaini113 – 295CytoplasmicSequence analysisAdd BLAST183
Transmembranei296 – 317HelicalSequence analysisAdd BLAST22
Topological domaini318 – 346Exoplasmic loopSequence analysisAdd BLAST29
Transmembranei347 – 368HelicalSequence analysisAdd BLAST22
Topological domaini369 – 889CytoplasmicSequence analysisAdd BLAST521
Transmembranei890 – 910HelicalSequence analysisAdd BLAST21
Topological domaini911 – 922Exoplasmic loopSequence analysisAdd BLAST12
Transmembranei923 – 942HelicalSequence analysisAdd BLAST20
Topological domaini943 – 972CytoplasmicSequence analysisAdd BLAST30
Transmembranei973 – 994HelicalSequence analysisAdd BLAST22
Topological domaini995 – 1008Exoplasmic loopSequence analysisAdd BLAST14
Transmembranei1009 – 1031HelicalSequence analysisAdd BLAST23
Topological domaini1032 – 1037CytoplasmicSequence analysis6
Transmembranei1038 – 1058HelicalSequence analysisAdd BLAST21
Topological domaini1059 – 1078Exoplasmic loopSequence analysisAdd BLAST20
Transmembranei1079 – 1103HelicalSequence analysisAdd BLAST25
Topological domaini1104 – 1209CytoplasmicSequence analysisAdd BLAST106

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000143515

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25167

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATP8B2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
30316371

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000463651 – 1209Phospholipid-transporting ATPase IDAdd BLAST1209

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1175PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P98198

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P98198

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P98198

PeptideAtlas

More...
PeptideAtlasi
P98198

PRoteomics IDEntifications database

More...
PRIDEi
P98198

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57827
57828 [P98198-2]
57829 [P98198-3]
57830 [P98198-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P98198

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P98198

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 3 is ubiquitous, with highest expression in aorta, cerebellum and uterus.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143515 Expressed in 206 organ(s), highest expression level in thoracic aorta

CleanEx database of gene expression profiles

More...
CleanExi
HS_ATP8B2

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P98198 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA046680

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a P4-ATPase flippase complex which consists of a catalytic alpha subunit and an accessory beta subunit (Probable). The probable flippase ATP8B2:TMEM30A complex can form an intermediate phosphoenzyme in vitro. The interaction with TMEM30B is reported conflictingly.Curated

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121445, 18 interactors

Protein interaction database and analysis system

More...
IntActi
P98198, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357475

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P98198

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0206 Eukaryota
COG0474 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160804

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000202528

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050601

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P98198

KEGG Orthology (KO)

More...
KOi
K01530

Identification of Orthologs from Complete Genome Data

More...
OMAi
DEEMYYA

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0139

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P98198

TreeFam database of animal gene trees

More...
TreeFami
TF300654

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1110.10, 2 hits
3.40.50.1000, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030347 ATP8B2
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006539 P-type_ATPase_IV
IPR032631 P-type_ATPase_N
IPR001757 P_typ_ATPase
IPR032630 P_typ_ATPase_c

The PANTHER Classification System

More...
PANTHERi
PTHR24092 PTHR24092, 1 hit
PTHR24092:SF46 PTHR24092:SF46, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16212 PhoLip_ATPase_C, 1 hit
PF16209 PhoLip_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01652 ATPase-Plipid, 1 hit
TIGR01494 ATPase_P-type, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P98198-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTVPKEMPEK WARAQAPPSW SRKKPSWGTE EERRARANDR EYNEKFQYAS
60 70 80 90 100
NCIKTSKYNI LTFLPVNLFE QFQEVANTYF LFLLILQLIP QISSLSWFTT
110 120 130 140 150
IVPLVLVLTI TAVKDATDDY FRHKSDNQVN NRQSQVLING ILQQEQWMNV
160 170 180 190 200
CVGDIIKLEN NQFVAADLLL LSSSEPHGLC YIETAELDGE TNMKVRQAIP
210 220 230 240 250
VTSELGDISK LAKFDGEVIC EPPNNKLDKF SGTLYWKENK FPLSNQNMLL
260 270 280 290 300
RGCVLRNTEW CFGLVIFAGP DTKLMQNSGR TKFKRTSIDR LMNTLVLWIF
310 320 330 340 350
GFLVCMGVIL AIGNAIWEHE VGMRFQVYLP WDEAVDSAFF SGFLSFWSYI
360 370 380 390 400
IILNTVVPIS LYVSVEVIRL GHSYFINWDK KMFCMKKRTP AEARTTTLNE
410 420 430 440 450
ELGQVEYIFS DKTGTLTQNI MVFNKCSING HSYGDVFDVL GHKAELGERP
460 470 480 490 500
EPVDFSFNPL ADKKFLFWDP SLLEAVKIGD PHTHEFFRLL SLCHTVMSEE
510 520 530 540 550
KNEGELYYKA QSPDEGALVT AARNFGFVFR SRTPKTITVH EMGTAITYQL
560 570 580 590 600
LAILDFNNIR KRMSVIVRNP EGKIRLYCKG ADTILLDRLH HSTQELLNTT
610 620 630 640 650
MDHLNEYAGE GLRTLVLAYK DLDEEYYEEW AERRLQASLA QDSREDRLAS
660 670 680 690 700
IYEEVENNMM LLGATAIEDK LQQGVPETIA LLTLANIKIW VLTGDKQETA
710 720 730 740 750
VNIGYSCKML TDDMTEVFIV TGHTVLEVRE ELRKAREKMM DSSRSVGNGF
760 770 780 790 800
TYQDKLSSSK LTSVLEAVAG EYALVINGHS LAHALEADME LEFLETACAC
810 820 830 840 850
KAVICCRVTP LQKAQVVELV KKYKKAVTLA IGDGANDVSM IKTAHIGVGI
860 870 880 890 900
SGQEGIQAVL ASDYSFSQFK FLQRLLLVHG RWSYLRMCKF LCYFFYKNFA
910 920 930 940 950
FTMVHFWFGF FCGFSAQTVY DQYFITLYNI VYTSLPVLAM GVFDQDVPEQ
960 970 980 990 1000
RSMEYPKLYE PGQLNLLFNK REFFICIAQG IYTSVLMFFI PYGVFADATR
1010 1020 1030 1040 1050
DDGTQLADYQ SFAVTVATSL VIVVSVQIGL DTGYWTAINH FFIWGSLAVY
1060 1070 1080 1090 1100
FAILFAMHSN GLFDMFPNQF RFVGNAQNTL AQPTVWLTIV LTTVVCIMPV
1110 1120 1130 1140 1150
VAFRFLRLNL KPDLSDTVRY TQLVRKKQKA QHRCMRRVGR TGSRRSGYAF
1160 1170 1180 1190 1200
SHQEGFGELI MSGKNMRLSS LALSSFTTRS SSSWIESLRR KKSDSASSPS

GGADKPLKG
Note: No experimental confirmation available.
Length:1,209
Mass (Da):137,440
Last modified:April 30, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD905A97E9D9724BD
GO
Isoform 2 (identifier: P98198-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-461: GDVFDVLGHKAELGERPEPVDFSFNPLA → VGSEGPRRKGPSWPGTVAHAYSHSTLGG
     462-1209: Missing.

Show »
Length:461
Mass (Da):52,624
Checksum:i15CAABEAAE6862DC
GO
Isoform 3 (identifier: P98198-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MDTLRAVPLFSISGLFSFPYRVSHGIAGILLGEMAVCAKKRPP

Show »
Length:1,223
Mass (Da):138,719
Checksum:i61AF805A0511A143
GO
Isoform 4 (identifier: P98198-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MAVCAKKRPP
     364-406: SVEVIRLGHS...TLNEELGQVE → RYVPSLTWGL...KSSSSCTVNI
     407-1209: Missing.

Show »
Length:387
Mass (Da):44,213
Checksum:iB4C17CA615F4F952
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH30288 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB70822 differs from that shown. Reason: Frameshift at position 364.Curated
The sequence BAG65556 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti834G → E in BAA86451 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0371471 – 29MTVPK…PSWGT → MDTLRAVPLFSISGLFSFPY RVSHGIAGILLGEMAVCAKK RPP in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0371481 – 29MTVPK…PSWGT → MAVCAKKRPP in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_037149364 – 406SVEVI…LGQVE → RYVPSLTWGLSRESGGPIEL FFSMKMKSLRSNEKSSSSCT VNI in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_037150407 – 1209Missing in isoform 4. 1 PublicationAdd BLAST803
Alternative sequenceiVSP_007302434 – 461GDVFD…FNPLA → VGSEGPRRKGPSWPGTVAHA YSHSTLGG in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_007303462 – 1209Missing in isoform 2. 1 PublicationAdd BLAST748

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY302537 mRNA Translation: AAQ19027.1
AK054886 mRNA Translation: BAB70822.1 Frameshift.
AK304806 mRNA Translation: BAG65556.1 Different initiation.
AL162591 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53205.1
BC007837 mRNA Translation: AAH07837.2
BC030288 mRNA Translation: AAH30288.1 Different initiation.
BC069264 mRNA Translation: AAH69264.1
AB032963 mRNA Translation: BAA86451.1
AL137537 mRNA Translation: CAB70799.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1066.1 [P98198-3]
CCDS41405.1 [P98198-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46381

NCBI Reference Sequences

More...
RefSeqi
NP_001005855.1, NM_001005855.1 [P98198-4]
NP_065185.1, NM_020452.3 [P98198-3]
XP_005245412.1, XM_005245355.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.435700

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000368487; ENSP00000357472; ENSG00000143515 [P98198-4]
ENST00000368489; ENSP00000357475; ENSG00000143515 [P98198-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57198

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57198

UCSC genome browser

More...
UCSCi
uc001few.4 human [P98198-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302537 mRNA Translation: AAQ19027.1
AK054886 mRNA Translation: BAB70822.1 Frameshift.
AK304806 mRNA Translation: BAG65556.1 Different initiation.
AL162591 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53205.1
BC007837 mRNA Translation: AAH07837.2
BC030288 mRNA Translation: AAH30288.1 Different initiation.
BC069264 mRNA Translation: AAH69264.1
AB032963 mRNA Translation: BAA86451.1
AL137537 mRNA Translation: CAB70799.1
CCDSiCCDS1066.1 [P98198-3]
CCDS41405.1 [P98198-4]
PIRiT46381
RefSeqiNP_001005855.1, NM_001005855.1 [P98198-4]
NP_065185.1, NM_020452.3 [P98198-3]
XP_005245412.1, XM_005245355.2
UniGeneiHs.435700

3D structure databases

ProteinModelPortaliP98198
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121445, 18 interactors
IntActiP98198, 2 interactors
STRINGi9606.ENSP00000357475

PTM databases

iPTMnetiP98198
PhosphoSitePlusiP98198

Polymorphism and mutation databases

BioMutaiATP8B2
DMDMi30316371

Proteomic databases

EPDiP98198
MaxQBiP98198
PaxDbiP98198
PeptideAtlasiP98198
PRIDEiP98198
ProteomicsDBi57827
57828 [P98198-2]
57829 [P98198-3]
57830 [P98198-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57198
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368487; ENSP00000357472; ENSG00000143515 [P98198-4]
ENST00000368489; ENSP00000357475; ENSG00000143515 [P98198-3]
GeneIDi57198
KEGGihsa:57198
UCSCiuc001few.4 human [P98198-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57198
EuPathDBiHostDB:ENSG00000143515.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATP8B2
HGNCiHGNC:13534 ATP8B2
HPAiHPA046680
MIMi605867 gene
neXtProtiNX_P98198
OpenTargetsiENSG00000143515
PharmGKBiPA25167

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0206 Eukaryota
COG0474 LUCA
GeneTreeiENSGT00940000160804
HOGENOMiHOG000202528
HOVERGENiHBG050601
InParanoidiP98198
KOiK01530
OMAiDEEMYYA
OrthoDBiEOG091G0139
PhylomeDBiP98198
TreeFamiTF300654

Enzyme and pathway databases

ReactomeiR-HSA-936837 Ion transport by P-type ATPases

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57198

Protein Ontology

More...
PROi
PR:P98198

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143515 Expressed in 206 organ(s), highest expression level in thoracic aorta
CleanExiHS_ATP8B2
GenevisibleiP98198 HS

Family and domain databases

Gene3Di3.40.1110.10, 2 hits
3.40.50.1000, 2 hits
InterProiView protein in InterPro
IPR030347 ATP8B2
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006539 P-type_ATPase_IV
IPR032631 P-type_ATPase_N
IPR001757 P_typ_ATPase
IPR032630 P_typ_ATPase_c
PANTHERiPTHR24092 PTHR24092, 1 hit
PTHR24092:SF46 PTHR24092:SF46, 1 hit
PfamiView protein in Pfam
PF16212 PhoLip_ATPase_C, 1 hit
PF16209 PhoLip_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01652 ATPase-Plipid, 1 hit
TIGR01494 ATPase_P-type, 1 hit
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT8B2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P98198
Secondary accession number(s): B4E3P4
, Q6NT69, Q7Z486, Q96I43, Q96NQ7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: April 30, 2003
Last modified: December 5, 2018
This is version 167 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again