Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P98194 (AT2C1_HUMAN)

Entry version 207 (11 Dec 2019)
Sequence version 3 (21 Jun 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-transporting ATPase type 2C member 1

Gene

ATP2C1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi303Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi306Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi308Calcium 2By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3504-aspartylphosphate intermediateBy similarity1
Metal bindingi644MagnesiumBy similarity1
Metal bindingi648MagnesiumBy similarity1
Metal bindingi738Calcium 2By similarity1
Metal bindingi742Calcium 2By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTranslocase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.6.3.8 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-936837 Ion transport by P-type ATPases

SIGNOR Signaling Network Open Resource

More...SIGNORi		P98194

Protein family/group databases

Transport Classification Database

More...TCDBi		3.A.3.2.5 the p-type atpase (p-atpase) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-transporting ATPase type 2C member 1 (EC:7.2.2.10)
Short name:
ATPase 2C1
Alternative name(s):
ATP-dependent Ca(2+) pump PMR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP2C1
Synonyms:KIAA1347, PMR1L
ORF Names:HUSSY-28
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000017260.19

Human Gene Nomenclature Database

More...HGNCi		HGNC:13211 ATP2C1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604384 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P98194

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 70CytoplasmicBy similarityAdd BLAST70
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei71 – 91Helical; Name=1By similarityAdd BLAST21
Topological domaini92 – 104LumenalBy similarityAdd BLAST13
Transmembranei105 – 123Helical; Name=2By similarityAdd BLAST19
Topological domaini124 – 262CytoplasmicBy similarityAdd BLAST139
Transmembranei263 – 282Helical; Name=3By similarityAdd BLAST20
Topological domaini283 – 294LumenalBy similarityAdd BLAST12
Transmembranei295 – 312Helical; Name=4By similarityAdd BLAST18
Topological domaini313 – 699CytoplasmicBy similarityAdd BLAST387
Transmembranei700 – 719Helical; Name=5By similarityAdd BLAST20
Topological domaini720 – 729LumenalBy similarity10
Transmembranei730 – 750Helical; Name=6By similarityAdd BLAST21
Topological domaini751 – 770CytoplasmicBy similarityAdd BLAST20
Transmembranei771 – 793Helical; Name=7By similarityAdd BLAST23
Topological domaini794 – 808LumenalBy similarityAdd BLAST15
Transmembranei809 – 828Helical; Name=8By similarityAdd BLAST20
Topological domaini829 – 841CytoplasmicBy similarityAdd BLAST13
Transmembranei842 – 860Helical; Name=9By similarityAdd BLAST19
Topological domaini861 – 875LumenalBy similarityAdd BLAST15
Transmembranei876 – 896Helical; Name=10By similarityAdd BLAST21
Topological domaini897 – 919CytoplasmicBy similarityAdd BLAST23

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hailey-Hailey disease (HHD)5 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAutosomal dominant disorder characterized by persistent blisters and suprabasal cell separation (acantholysis) of the epidermis, due to impaired keratinocyte adhesion. Patients lacking all isoforms except isoform 2 have HHD.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_010130201P → L in HHD. 1 Publication1
Natural variantiVAR_079698220G → E in HHD. 1 Publication1
Natural variantiVAR_008803304A → T in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853012EnsemblClinVar.1
Natural variantiVAR_022672309G → C in HHD. 1 Publication1
Natural variantiVAR_079699309G → V in HHD. 1 PublicationCorresponds to variant dbSNP:rs1393570830Ensembl.1
Natural variantiVAR_008804318L → P in HHD. 1 Publication1
Natural variantiVAR_022673341L → P in HHD. 1 Publication1
Natural variantiVAR_010131344C → Y in HHD. 1 Publication1
Natural variantiVAR_022674411C → R in HHD. 1 Publication1
Natural variantiVAR_019523490C → F in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853014EnsemblClinVar.1
Natural variantiVAR_010132570T → I in HHD. 1 Publication1
Natural variantiVAR_022675580I → V in HHD. 1 PublicationCorresponds to variant dbSNP:rs1282232888Ensembl.1
Natural variantiVAR_019524584L → P in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853015EnsemblClinVar.1
Natural variantiVAR_079700609 – 919Missing in HHD. 1 PublicationAdd BLAST311
Natural variantiVAR_008805641M → R in HHD. 1 Publication1
Natural variantiVAR_008806645G → R in HHD. 1 Publication1
Natural variantiVAR_008807709T → M in HHD. 1 PublicationCorresponds to variant dbSNP:rs778865612Ensembl.1
Natural variantiVAR_079701730 – 731Missing in HHD. 1 Publication2
Natural variantiVAR_079702731A → D in HHD. 1 Publication1
Natural variantiVAR_022676742D → Y in HHD. 1 Publication1
Natural variantiVAR_008808744P → R in HHD. 1 Publication1
Natural variantiVAR_022677789G → R in HHD. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		27032

MalaCards human disease database

More...MalaCardsi		ATP2C1
MIMi169600 phenotype

Open Targets

More...OpenTargetsi		ENSG00000017260

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2841 Familial benign chronic pemphigus

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25111

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P98194 Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB01373 Calcium
DB01189 Desflurane
DB00228 Enflurane
DB01159 Halothane
DB00753 Isoflurane
DB01028 Methoxyflurane
DB01236 Sevoflurane

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ATP2C1

Domain mapping of disease mutations (DMDM)

More...DMDMi		68068024

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462231 – 919Calcium-transporting ATPase type 2C member 1Add BLAST919

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P98194

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P98194

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P98194

MaxQB - The MaxQuant DataBase

More...MaxQBi		P98194

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P98194

PeptideAtlas

More...PeptideAtlasi		P98194

PRoteomics IDEntifications database

More...PRIDEi		P98194

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		33752
34290
57820 [P98194-1]
57821 [P98194-2]
57822 [P98194-3]
57823 [P98194-4]
57824 [P98194-5]
57825 [P98194-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P98194

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P98194

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P98194

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in most tissues except colon, thymus, spleen and leukocytes. Most abundant in keratinocytes and kidney.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000017260 Expressed in 229 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P98194 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P98194 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB010207
HPA035116
HPA069684

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		117963, 25 interactors

Protein interaction database and analysis system

More...IntActi		P98194, 24 interactors

Molecular INTeraction database

More...MINTi		P98194

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000421326

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P98194 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P98194

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0202 Eukaryota
COG0474 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156421

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000265621

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P98194

KEGG Orthology (KO)

More...KOi		K01537

Identification of Orthologs from Complete Genome Data

More...OMAi		VGMSDPP

Database of Orthologous Groups

More...OrthoDBi		1122184at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P98194

TreeFam database of animal gene trees

More...TreeFami		TF354251

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR030336 ATP2C1
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006413 P-type_ATPase_IIA_PMR1
IPR001757 P_typ_ATPase

The PANTHER Classification System

More...PANTHERi		PTHR42861:SF2 PTHR42861:SF2, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00120 HATPASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00831 Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81665 SSF81665, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01522 ATPase-IIA2_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoform 1 and isoform 2 are expressed in the same tissues.

This entry has 9 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P98194-1) [UniParc]FASTAAdd to basket
Also known as: ATP2C1A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKVARFQKIP NGENETMIPV LTSKKASELP VSEVASILQA DLQNGLNKCE 
        60         70         80         90        100
VSHRRAFHGW NEFDISEDEP LWKKYISQFK NPLIMLLLAS AVISVLMHQF 
       110        120        130        140        150
DDAVSITVAI LIVVTVAFVQ EYRSEKSLEE LSKLVPPECH CVREGKLEHT 
       160        170        180        190        200
LARDLVPGDT VCLSVGDRVP ADLRLFEAVD LSIDESSLTG ETTPCSKVTA 
       210        220        230        240        250
PQPAATNGDL ASRSNIAFMG TLVRCGKAKG VVIGTGENSE FGEVFKMMQA 
       260        270        280        290        300
EEAPKTPLQK SMDLLGKQLS FYSFGIIGII MLVGWLLGKD ILEMFTISVS 
       310        320        330        340        350
LAVAAIPEGL PIVVTVTLAL GVMRMVKKRA IVKKLPIVET LGCCNVICSD 
       360        370        380        390        400
KTGTLTKNEM TVTHIFTSDG LHAEVTGVGY NQFGEVIVDG DVVHGFYNPA 
       410        420        430        440        450
VSRIVEAGCV CNDAVIRNNT LMGKPTEGAL IALAMKMGLD GLQQDYIRKA 
       460        470        480        490        500
EYPFSSEQKW MAVKCVHRTQ QDRPEICFMK GAYEQVIKYC TTYQSKGQTL 
       510        520        530        540        550
TLTQQQRDVY QQEKARMGSA GLRVLALASG PELGQLTFLG LVGIIDPPRT 
       560        570        580        590        600
GVKEAVTTLI ASGVSIKMIT GDSQETAVAI ASRLGLYSKT SQSVSGEEID 
       610        620        630        640        650
AMDVQQLSQI VPKVAVFYRA SPRHKMKIIK SLQKNGSVVA MTGDGVNDAV 
       660        670        680        690        700
ALKAADIGVA MGQTGTDVCK EAADMILVDD DFQTIMSAIE EGKGIYNNIK 
       710        720        730        740        750
NFVRFQLSTS IAALTLISLA TLMNFPNPLN AMQILWINII MDGPPAQSLG 
       760        770        780        790        800
VEPVDKDVIR KPPRNWKDSI LTKNLILKIL VSSIIIVCGT LFVFWRELRD 
       810        820        830        840        850
NVITPRDTTM TFTCFVFFDM FNALSSRSQT KSVFEIGLCS NRMFCYAVLG 
       860        870        880        890        900
SIMGQLLVIY FPPLQKVFQT ESLSILDLLF LLGLTSSVCI VAEIIKKVER 
       910 
SREKIQKHVS STSSSFLEV
Length:919
Mass (Da):100,577
Last modified:June 21, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C1495D58FDA7EA1
GO
Isoform 2 (identifier: P98194-2) [UniParc]FASTAAdd to basket
Also known as: ATP2C1B, ATP2C1C

The sequence of this isoform differs from the canonical sequence as follows:
     877-919: DLLFLLGLTSSVCIVAEIIKKVERSREKIQKHVSSTSSSFLEV → GLALGEEWTAAG

Show »
Length:888
Mass (Da):96,960
Checksum:i27E2B0E13378BB98
GO
Isoform 3 (identifier: P98194-3) [UniParc]FASTAAdd to basket
Also known as: ATP2C1B

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.
     910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV

Show »
Length:923
Mass (Da):101,163
Checksum:iA7962E652B936D76
GO
Isoform 4 (identifier: P98194-4) [UniParc]FASTAAdd to basket
Also known as: ATP2C1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:903
Mass (Da):98,733
Checksum:iD15118E067B15ED4
GO
Isoform 5 (identifier: P98194-5) [UniParc]FASTAAdd to basket
Also known as: ATP2C1B

The sequence of this isoform differs from the canonical sequence as follows:
     910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV

Show »
Length:939
Mass (Da):103,007
Checksum:iE6B6914D20DFD0B7
GO
Isoform 6 (identifier: P98194-6) [UniParc]FASTAAdd to basket
Also known as: ATP2C1D

The sequence of this isoform differs from the canonical sequence as follows:
     919-919: V → VSSTSSSFLEVWLWERSGQQLVEIHPHLETGLPLTEDVSCV

Show »
Length:959
Mass (Da):105,057
Checksum:iC25B54ABDE014607
GO
Isoform 7 (identifier: P98194-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MK → MDSLLPPSRFSYFKKYPLHAIRRYLSTLRNQRAEEQ
     910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV

Show »
Length:973
Mass (Da):107,143
Checksum:i0AC81DFDBA5DAB98
GO
Isoform 8 (identifier: P98194-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MK → MDSLLPPSRFSYFKKYPLHAIRRYLSTLRNQRAEEQ
     39-77: Missing.
     919-919: V → VWLWERSGQQLVEIHPHLETGLPLTEDVSCV

Show »
Length:944
Mass (Da):103,524
Checksum:i16F4A201591E4EA8
GO
Isoform 9 (identifier: P98194-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     919-919: V → VWLWERSGQQLVEIHPHLETGLPLTEDVSCV

Show »
Length:949
Mass (Da):104,032
Checksum:iDA7EBA526743BEDF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4E2Q0B4E2Q0_HUMAN
Calcium-transporting ATPase
ATP2C1 hCG_14809
953Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9V7H0Y9V7_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
903Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9U9D6R9U9_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6REJ1D6REJ1_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9S7H0Y9S7_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
314Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHV9D6RHV9_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8X9H0Y8X9_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGE9D6RGE9_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAH2H0YAH2_HUMAN
Calcium-transporting ATPase type 2C...
ATP2C1
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92585 differs from that shown. Reason: Frameshift.Curated
The sequence BAC11142 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti62E → K in AAF26295 (PubMed:10615129).Curated1
Sequence conflicti62E → K in AAF26296 (PubMed:10615129).Curated1
Sequence conflicti112I → F in AAF35375 (PubMed:10767338).Curated1
Sequence conflicti150T → I in BAC11142 (PubMed:14702039).Curated1
Sequence conflicti346V → A in BAH12365 (PubMed:14702039).Curated1
Sequence conflicti373A → T in AAF26295 (PubMed:10615129).Curated1
Sequence conflicti373A → T in AAF26296 (PubMed:10615129).Curated1
Sequence conflicti516R → H in CAA09425 (PubMed:11124703).Curated1
Sequence conflicti713A → T in BAC11142 (PubMed:14702039).Curated1
Sequence conflicti868F → L in BAG61775 (PubMed:14702039).Curated1
Sequence conflicti901S → G in BAC11142 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_010130201P → L in HHD. 1 Publication1
Natural variantiVAR_079698220G → E in HHD. 1 Publication1
Natural variantiVAR_008803304A → T in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853012EnsemblClinVar.1
Natural variantiVAR_022672309G → C in HHD. 1 Publication1
Natural variantiVAR_079699309G → V in HHD. 1 PublicationCorresponds to variant dbSNP:rs1393570830Ensembl.1
Natural variantiVAR_008804318L → P in HHD. 1 Publication1
Natural variantiVAR_022673341L → P in HHD. 1 Publication1
Natural variantiVAR_010131344C → Y in HHD. 1 Publication1
Natural variantiVAR_022674411C → R in HHD. 1 Publication1
Natural variantiVAR_048373450A → T. Corresponds to variant dbSNP:rs41434650EnsemblClinVar.1
Natural variantiVAR_019523490C → F in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853014EnsemblClinVar.1
Natural variantiVAR_010132570T → I in HHD. 1 Publication1
Natural variantiVAR_022675580I → V in HHD. 1 PublicationCorresponds to variant dbSNP:rs1282232888Ensembl.1
Natural variantiVAR_019524584L → P in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853015EnsemblClinVar.1
Natural variantiVAR_079700609 – 919Missing in HHD. 1 PublicationAdd BLAST311
Natural variantiVAR_008805641M → R in HHD. 1 Publication1
Natural variantiVAR_008806645G → R in HHD. 1 Publication1
Natural variantiVAR_008807709T → M in HHD. 1 PublicationCorresponds to variant dbSNP:rs778865612Ensembl.1
Natural variantiVAR_079701730 – 731Missing in HHD. 1 Publication2
Natural variantiVAR_079702731A → D in HHD. 1 Publication1
Natural variantiVAR_022676742D → Y in HHD. 1 Publication1
Natural variantiVAR_008808744P → R in HHD. 1 Publication1
Natural variantiVAR_022677789G → R in HHD. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0004081 – 16Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_0458921 – 2MK → MDSLLPPSRFSYFKKYPLHA IRRYLSTLRNQRAEEQ in isoform 7 and isoform 8. 1 Publication2
Alternative sequenceiVSP_05503639 – 77Missing in isoform 8. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_000409877 – 919DLLFL…SFLEV → GLALGEEWTAAG in isoform 2. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_000410910 – 919SSTSSSFLEV → WLWERSGQQLVEIHPHLETG LPLTEDVSCV in isoform 3, isoform 5 and isoform 7. 3 Publications10
Alternative sequenceiVSP_014102919V → VSSTSSSFLEVWLWERSGQQ LVEIHPHLETGLPLTEDVSC V in isoform 6. 2 Publications1
Alternative sequenceiVSP_055037919V → VWLWERSGQQLVEIHPHLET GLPLTEDVSCV in isoform 9 and isoform 8. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF181120 mRNA Translation: AAF26295.1
AF181121 mRNA Translation: AAF26296.1
AF189723 mRNA Translation: AAF27813.2
AF225981 mRNA Translation: AAF35375.1
AY268374 mRNA Translation: AAP30008.1
AY268375 mRNA Translation: AAP30009.1
AB037768 mRNA Translation: BAA92585.1 Frameshift.
AK001684 mRNA Translation: BAA91835.1
AK074692 mRNA Translation: BAC11142.1 Different initiation.
AK296470 mRNA Translation: BAH12365.1
AK299945 mRNA Translation: BAG61775.1
AK314342 mRNA Translation: BAG36984.1
AC055733 Genomic DNA No translation available.
AC097105 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79218.1
CH471052 Genomic DNA Translation: EAW79219.1
BC028139 mRNA Translation: AAH28139.1
AJ010953 mRNA Translation: CAA09425.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33856.1 [P98194-9]
CCDS46912.1 [P98194-5]
CCDS46913.1 [P98194-2]
CCDS46914.1 [P98194-1]
CCDS56278.1 [P98194-7]
CCDS56279.1 [P98194-8]
CCDS56280.1 [P98194-3]
CCDS56281.1 [P98194-4]

NCBI Reference Sequences

More...RefSeqi		NP_001001485.1, NM_001001485.2 [P98194-2]
NP_001001486.1, NM_001001486.1 [P98194-9]
NP_001001487.1, NM_001001487.1 [P98194-5]
NP_001186108.1, NM_001199179.1 [P98194-1]
NP_001186109.1, NM_001199180.1 [P98194-7]
NP_001186110.1, NM_001199181.1
NP_001186111.1, NM_001199182.1 [P98194-8]
NP_001186112.1, NM_001199183.1 [P98194-3]
NP_001186113.1, NM_001199184.1 [P98194-4]
NP_001186114.1, NM_001199185.1 [P98194-2]
NP_055197.2, NM_014382.3 [P98194-1]
XP_005247412.1, XM_005247355.2 [P98194-9]
XP_005247413.1, XM_005247356.2 [P98194-9]
XP_016861653.1, XM_017006164.1 [P98194-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000328560; ENSP00000329664; ENSG00000017260 [P98194-2]
ENST00000359644; ENSP00000352665; ENSG00000017260 [P98194-9]
ENST00000422190; ENSP00000402677; ENSG00000017260 [P98194-5]
ENST00000428331; ENSP00000395809; ENSG00000017260 [P98194-1]
ENST00000504381; ENSP00000425320; ENSG00000017260 [P98194-8]
ENST00000504948; ENSP00000423330; ENSG00000017260 [P98194-4]
ENST00000507488; ENSP00000421326; ENSG00000017260 [P98194-7]
ENST00000508532; ENSP00000424783; ENSG00000017260 [P98194-1]
ENST00000510168; ENSP00000427461; ENSG00000017260 [P98194-1]
ENST00000513801; ENSP00000422872; ENSG00000017260 [P98194-3]
ENST00000533801; ENSP00000432956; ENSG00000017260 [P98194-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		27032

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:27032

UCSC genome browser

More...UCSCi		uc003enk.4 human [P98194-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF181120 mRNA Translation: AAF26295.1
AF181121 mRNA Translation: AAF26296.1
AF189723 mRNA Translation: AAF27813.2
AF225981 mRNA Translation: AAF35375.1
AY268374 mRNA Translation: AAP30008.1
AY268375 mRNA Translation: AAP30009.1
AB037768 mRNA Translation: BAA92585.1 Frameshift.
AK001684 mRNA Translation: BAA91835.1
AK074692 mRNA Translation: BAC11142.1 Different initiation.
AK296470 mRNA Translation: BAH12365.1
AK299945 mRNA Translation: BAG61775.1
AK314342 mRNA Translation: BAG36984.1
AC055733 Genomic DNA No translation available.
AC097105 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79218.1
CH471052 Genomic DNA Translation: EAW79219.1
BC028139 mRNA Translation: AAH28139.1
AJ010953 mRNA Translation: CAA09425.1
CCDSiCCDS33856.1 [P98194-9]
CCDS46912.1 [P98194-5]
CCDS46913.1 [P98194-2]
CCDS46914.1 [P98194-1]
CCDS56278.1 [P98194-7]
CCDS56279.1 [P98194-8]
CCDS56280.1 [P98194-3]
CCDS56281.1 [P98194-4]
RefSeqiNP_001001485.1, NM_001001485.2 [P98194-2]
NP_001001486.1, NM_001001486.1 [P98194-9]
NP_001001487.1, NM_001001487.1 [P98194-5]
NP_001186108.1, NM_001199179.1 [P98194-1]
NP_001186109.1, NM_001199180.1 [P98194-7]
NP_001186110.1, NM_001199181.1
NP_001186111.1, NM_001199182.1 [P98194-8]
NP_001186112.1, NM_001199183.1 [P98194-3]
NP_001186113.1, NM_001199184.1 [P98194-4]
NP_001186114.1, NM_001199185.1 [P98194-2]
NP_055197.2, NM_014382.3 [P98194-1]
XP_005247412.1, XM_005247355.2 [P98194-9]
XP_005247413.1, XM_005247356.2 [P98194-9]
XP_016861653.1, XM_017006164.1 [P98194-5]

3D structure databases

SMRiP98194
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117963, 25 interactors
IntActiP98194, 24 interactors
MINTiP98194
STRINGi9606.ENSP00000421326

Chemistry databases

DrugBankiDB01373 Calcium
DB01189 Desflurane
DB00228 Enflurane
DB01159 Halothane
DB00753 Isoflurane
DB01028 Methoxyflurane
DB01236 Sevoflurane

Protein family/group databases

TCDBi3.A.3.2.5 the p-type atpase (p-atpase) superfamily

PTM databases

iPTMnetiP98194
PhosphoSitePlusiP98194
SwissPalmiP98194

Polymorphism and mutation databases

BioMutaiATP2C1
DMDMi68068024

Proteomic databases

EPDiP98194
jPOSTiP98194
MassIVEiP98194
MaxQBiP98194
PaxDbiP98194
PeptideAtlasiP98194
PRIDEiP98194
ProteomicsDBi33752
34290
57820 [P98194-1]
57821 [P98194-2]
57822 [P98194-3]
57823 [P98194-4]
57824 [P98194-5]
57825 [P98194-6]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		27032

Genome annotation databases

EnsembliENST00000328560; ENSP00000329664; ENSG00000017260 [P98194-2]
ENST00000359644; ENSP00000352665; ENSG00000017260 [P98194-9]
ENST00000422190; ENSP00000402677; ENSG00000017260 [P98194-5]
ENST00000428331; ENSP00000395809; ENSG00000017260 [P98194-1]
ENST00000504381; ENSP00000425320; ENSG00000017260 [P98194-8]
ENST00000504948; ENSP00000423330; ENSG00000017260 [P98194-4]
ENST00000507488; ENSP00000421326; ENSG00000017260 [P98194-7]
ENST00000508532; ENSP00000424783; ENSG00000017260 [P98194-1]
ENST00000510168; ENSP00000427461; ENSG00000017260 [P98194-1]
ENST00000513801; ENSP00000422872; ENSG00000017260 [P98194-3]
ENST00000533801; ENSP00000432956; ENSG00000017260 [P98194-2]
GeneIDi27032
KEGGihsa:27032
UCSCiuc003enk.4 human [P98194-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		27032
DisGeNETi27032
EuPathDBiHostDB:ENSG00000017260.19

GeneCards: human genes, protein and diseases

More...GeneCardsi		ATP2C1
HGNCiHGNC:13211 ATP2C1
HPAiCAB010207
HPA035116
HPA069684
MalaCardsiATP2C1
MIMi169600 phenotype
604384 gene
neXtProtiNX_P98194
OpenTargetsiENSG00000017260
Orphaneti2841 Familial benign chronic pemphigus
PharmGKBiPA25111

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0202 Eukaryota
COG0474 LUCA
GeneTreeiENSGT00940000156421
HOGENOMiHOG000265621
InParanoidiP98194
KOiK01537
OMAiVGMSDPP
OrthoDBi1122184at2759
PhylomeDBiP98194
TreeFamiTF354251

Enzyme and pathway databases

BRENDAi3.6.3.8 2681
ReactomeiR-HSA-936837 Ion transport by P-type ATPases
SIGNORiP98194

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ATP2C1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ATP2C1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		27032
PharosiP98194 Tbio

Protein Ontology

More...PROi		PR:P98194
RNActiP98194 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000017260 Expressed in 229 organ(s), highest expression level in corpus callosum
ExpressionAtlasiP98194 baseline and differential
GenevisibleiP98194 HS

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR030336 ATP2C1
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006413 P-type_ATPase_IIA_PMR1
IPR001757 P_typ_ATPase
PANTHERiPTHR42861:SF2 PTHR42861:SF2, 1 hit
PfamiView protein in Pfam
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
PRINTSiPR00120 HATPASE
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01522 ATPase-IIA2_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2C1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P98194
Secondary accession number(s): B2RAT7
, B4DSW3, B7Z3X9, G3XAH8, G8JLN9, O76005, Q86V72, Q86V73, Q8N6V1, Q8NCJ7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: June 21, 2005
Last modified: December 11, 2019
This is version 207 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again