Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P98194 (AT2C1_HUMAN)

Entry version 215 (02 Jun 2021)
Sequence version 3 (21 Jun 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Calcium-transporting ATPase type 2C member 1

Gene

ATP2C1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ATP-driven pump that supplies the Golgi apparatus with Ca2+ and Mn2+ ions, both essential cofactors for processing and trafficking of newly synthesized proteins in the secretory pathway (PubMed:16192278, PubMed:30923126, PubMed:21187401, PubMed:12707275, PubMed:20439740).

Within a catalytic cycle, acquires Ca2+ or Mn2+ ions on the cytoplasmic side of the membrane and delivers them to the lumenal side. The transfer of ions across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation that shifts the pump conformation from inward-facing to outward-facing state (PubMed:16192278, PubMed:16332677, PubMed:30923126).

Plays a primary role in the maintenance of Ca2+ homeostasis in the trans-Golgi compartment with a functional impact on Golgi and post-Golgi protein sorting as well as a structural impact on cisternae morphology (PubMed:20439740, PubMed:14632183).

Responsible for loading the Golgi stores with Ca2+ ions in keratinocytes, contributing to keratinocyte differentiation and epidermis integrity (PubMed:14632183, PubMed:10615129, PubMed:20439740).

Participates in Ca2+ and Mn2+ ions uptake into the Golgi store of hippocampal neurons and regulates protein trafficking required for neural polarity (By similarity).

May also play a role in the maintenance of Ca2+ and Mn2+ homeostasis and signaling in the cytosol while preventing cytotoxicity (PubMed:21187401).

By similarity8 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.13 µM for Ca2+ (Ca2+-dependent ATP hydrolysis)1 Publication
  2. KM=0.07 µM for Mn2+ (Mn2+-dependent ATP hydrolysis)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi303Calcium 2; via carbonyl oxygenBy similarity1
    Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
    Metal bindingi306Calcium 2; via carbonyl oxygenBy similarity1
    Metal bindingi308Calcium 2By similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3504-aspartylphosphate intermediateBy similarity1
    Metal bindingi644MagnesiumBy similarity1
    Metal bindingi648MagnesiumBy similarity1
    Metal bindingi738Calcium 2By similarity1
    Metal bindingi742Calcium 2By similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionTranslocase
    Biological processCalcium transport, Ion transport, Transport
    LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		7.2.2.10, 2681

    Pathway Commons web resource for biological pathway data

    More...    PathwayCommonsi    		P98194

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-936837, Ion transport by P-type ATPases

    SIGNOR Signaling Network Open Resource

    More...    SIGNORi    		P98194

    Protein family/group databases

    Transport Classification Database

    More...    TCDBi    		3.A.3.2.5, the p-type atpase (p-atpase) superfamily

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Calcium-transporting ATPase type 2C member 1 (EC:7.2.2.102 Publications)
    Short name:
    ATPase 2C11 Publication
    Alternative name(s):
    ATP-dependent Ca(2+) pump PMR1
    Ca(2+)/Mn(2+)-ATPase 2C11 Publication
    Secretory pathway Ca(2+)-transporting ATPase type 1
    Short name:
    SPCA11 Publication
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:ATP2C11 PublicationImported
    Synonyms:KIAA1347, PMR1L
    ORF Names:HUSSY-28
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:13211, ATP2C1

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		604384, gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_P98194

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...    VEuPathDBi    		HostDB:ENSG00000017260.19

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 70CytoplasmicBy similarityAdd BLAST70
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei71 – 91Helical; Name=1By similarityAdd BLAST21
    Topological domaini92 – 104LumenalBy similarityAdd BLAST13
    Transmembranei105 – 123Helical; Name=2By similarityAdd BLAST19
    Topological domaini124 – 262CytoplasmicBy similarityAdd BLAST139
    Transmembranei263 – 282Helical; Name=3By similarityAdd BLAST20
    Topological domaini283 – 294LumenalBy similarityAdd BLAST12
    Transmembranei295 – 312Helical; Name=4By similarityAdd BLAST18
    Topological domaini313 – 699CytoplasmicBy similarityAdd BLAST387
    Transmembranei700 – 719Helical; Name=5By similarityAdd BLAST20
    Topological domaini720 – 729LumenalBy similarity10
    Transmembranei730 – 750Helical; Name=6By similarityAdd BLAST21
    Topological domaini751 – 770CytoplasmicBy similarityAdd BLAST20
    Transmembranei771 – 793Helical; Name=7By similarityAdd BLAST23
    Topological domaini794 – 808LumenalBy similarityAdd BLAST15
    Transmembranei809 – 828Helical; Name=8By similarityAdd BLAST20
    Topological domaini829 – 841CytoplasmicBy similarityAdd BLAST13
    Transmembranei842 – 860Helical; Name=9By similarityAdd BLAST19
    Topological domaini861 – 875LumenalBy similarityAdd BLAST15
    Transmembranei876 – 896Helical; Name=10By similarityAdd BLAST21
    Topological domaini897 – 919CytoplasmicBy similarityAdd BLAST23

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Hailey-Hailey disease (HHD)7 Publications
    The disease is caused by variants affecting the gene represented in this entry.
    Disease descriptionAutosomal dominant disorder characterized by persistent blisters and suprabasal cell separation (acantholysis) of the epidermis, due to impaired keratinocyte adhesion. Patients lacking all isoforms except isoform 2 have HHD.
    Related information in OMIM
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_010130201P → L in HHD; has normal catalytic cycle. 2 Publications1
    Natural variantiVAR_079698220G → E in HHD. 1 Publication1
    Natural variantiVAR_008803304A → T in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853012EnsemblClinVar.1
    Natural variantiVAR_022672309G → C in HHD; impairs manganese-dependent autophosphorylation in the presence of ATP; impairs manganese transporter activity. 3 Publications1
    Natural variantiVAR_079699309G → V in HHD. 1 PublicationCorresponds to variant dbSNP:rs1393570830Ensembl.1
    Natural variantiVAR_008804318L → P in HHD. 1 Publication1
    Natural variantiVAR_022673341L → P in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_010131344C → Y in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_022674411C → R in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_019523490C → F in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853014EnsemblClinVar.1
    Natural variantiVAR_010132570T → I in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_022675580I → V in HHD; impairs phosphoenzyme dephosphorylation. 2 PublicationsCorresponds to variant dbSNP:rs1282232888Ensembl.1
    Natural variantiVAR_019524584L → P in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853015EnsemblClinVar.1
    Natural variantiVAR_079700609 – 919Missing in HHD. 1 PublicationAdd BLAST311
    Natural variantiVAR_008805641M → R in HHD. 1 Publication1
    Natural variantiVAR_008806645G → R in HHD. 1 Publication1
    Natural variantiVAR_008807709T → M in HHD. 1 PublicationCorresponds to variant dbSNP:rs778865612Ensembl.1
    Natural variantiVAR_079701730 – 731Missing in HHD. 1 Publication2
    Natural variantiVAR_079702731A → D in HHD. 1 Publication1
    Natural variantiVAR_022676742D → Y in HHD; impairs calcium- and manganese-dependent autophosphorylation. 2 Publications1
    Natural variantiVAR_008808744P → R in HHD. 1 Publication1
    Natural variantiVAR_022677789G → R in HHD; decreases protein expression. 2 Publications1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi39Q → C: Decreases calcium-dependent autophosphorylation. 1 Publication1
    Mutagenesisi41D → A: Decreases calcium-dependent autophosphorylation and the ATPase activity; when associated with A-50. 1 Publication1
    Mutagenesisi50E → A: Decreases calcium-dependent autophosphorylation and the ATPase activity; when associated with A-41. 1 Publication1
    Mutagenesisi50E → S: Decreases calcium-dependent autophosphorylation. 1 Publication1
    Mutagenesisi350D → A: Impairs pump activity. 1 Publication1
    Mutagenesisi747Q → A: Increases manganese transporter activity. 1 Publication1

    Keywords - Diseasei

    Disease variant

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		27032

    MalaCards human disease database

    More...    MalaCardsi    		ATP2C1
    MIMi169600, phenotype

    Open Targets

    More...    OpenTargetsi    		ENSG00000017260

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...    Orphaneti    		2841, Familial benign chronic pemphigus

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA25111

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		P98194, Tbio

    Chemistry databases

    Drug and drug target database

    More...    DrugBanki    		DB01373, Calcium
    DB01189, Desflurane
    DB00228, Enflurane
    DB00753, Isoflurane
    DB01028, Methoxyflurane
    DB01236, Sevoflurane

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		ATP2C1

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		68068024

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462231 – 919Calcium-transporting ATPase type 2C member 1Add BLAST919

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		P98194

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		P98194

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		P98194

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		P98194

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		P98194

    PeptideAtlas

    More...    PeptideAtlasi    		P98194

    PRoteomics IDEntifications database

    More...    PRIDEi    		P98194

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		33752
    34290
    57820 [P98194-1]
    57821 [P98194-2]
    57822 [P98194-3]
    57823 [P98194-4]
    57824 [P98194-5]
    57825 [P98194-6]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		P98194

    MetOSite database of methionine sulfoxide sites

    More...    MetOSitei    		P98194

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		P98194

    SwissPalm database of S-palmitoylation events

    More...    SwissPalmi    		P98194

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Found in most tissues except colon, thymus, spleen and leukocytes (PubMed:15831496). Expressed in keratinocytes (at protein level) (PubMed:15831496, PubMed:14632183).2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000017260, Expressed in corpus callosum and 241 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		P98194, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		P98194, HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		ENSG00000017260, Low tissue specificity

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer. Homodimer.

    1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		117963, 51 interactors

    Protein interaction database and analysis system

    More...    IntActi    		P98194, 27 interactors

    Molecular INTeraction database

    More...    MINTi    		P98194

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000421326

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		P98194, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		P98194

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification]Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG0202, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000156421

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_002360_3_3_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		P98194

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		VGMSDPP

    Database of Orthologous Groups

    More...    OrthoDBi    		100699at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		P98194

    TreeFam database of animal gene trees

    More...    TreeFami    		TF354251

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		3.40.1110.10, 1 hit
    3.40.50.1000, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR030336, ATP2C1
    IPR006068, ATPase_P-typ_cation-transptr_C
    IPR004014, ATPase_P-typ_cation-transptr_N
    IPR023299, ATPase_P-typ_cyto_dom_N
    IPR018303, ATPase_P-typ_P_site
    IPR023298, ATPase_P-typ_TM_dom_sf
    IPR008250, ATPase_P-typ_transduc_dom_A_sf
    IPR036412, HAD-like_sf
    IPR023214, HAD_sf
    IPR006413, P-type_ATPase_IIA_PMR1
    IPR001757, P_typ_ATPase
    IPR044492, P_typ_ATPase_HD_dom

    The PANTHER Classification System

    More...    PANTHERi    		PTHR42861:SF2, PTHR42861:SF2, 1 hit

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF00689, Cation_ATPase_C, 1 hit
    PF00690, Cation_ATPase_N, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...    PRINTSi    		PR00120, HATPASE

    Structure-Function Linkage Database

    More...    SFLDi    		SFLDF00027, p-type_atpase, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...    SMARTi    		View protein in SMART
    SM00831, Cation_ATPase_N, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF56784, SSF56784, 1 hit
    SSF81653, SSF81653, 1 hit
    SSF81665, SSF81665, 1 hit

    TIGRFAMs; a protein family database

    More...    TIGRFAMsi    		TIGR01522, ATPase-IIA2_Ca, 1 hit
    TIGR01494, ATPase_P-type, 3 hits

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS00154, ATPASE_E1_E2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Note: Isoform 1 and isoform 2 are expressed in the same tissues.

    This entry has 9 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: P98194-1) [UniParc]FASTAAdd to basket
    Also known as: ATP2C1A1 Publication

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MKVARFQKIP NGENETMIPV LTSKKASELP VSEVASILQA DLQNGLNKCE 
            60         70         80         90        100
    VSHRRAFHGW NEFDISEDEP LWKKYISQFK NPLIMLLLAS AVISVLMHQF 
           110        120        130        140        150
    DDAVSITVAI LIVVTVAFVQ EYRSEKSLEE LSKLVPPECH CVREGKLEHT 
           160        170        180        190        200
    LARDLVPGDT VCLSVGDRVP ADLRLFEAVD LSIDESSLTG ETTPCSKVTA 
           210        220        230        240        250
    PQPAATNGDL ASRSNIAFMG TLVRCGKAKG VVIGTGENSE FGEVFKMMQA 
           260        270        280        290        300
    EEAPKTPLQK SMDLLGKQLS FYSFGIIGII MLVGWLLGKD ILEMFTISVS 
           310        320        330        340        350
    LAVAAIPEGL PIVVTVTLAL GVMRMVKKRA IVKKLPIVET LGCCNVICSD 
           360        370        380        390        400
    KTGTLTKNEM TVTHIFTSDG LHAEVTGVGY NQFGEVIVDG DVVHGFYNPA 
           410        420        430        440        450
    VSRIVEAGCV CNDAVIRNNT LMGKPTEGAL IALAMKMGLD GLQQDYIRKA 
           460        470        480        490        500
    EYPFSSEQKW MAVKCVHRTQ QDRPEICFMK GAYEQVIKYC TTYQSKGQTL 
           510        520        530        540        550
    TLTQQQRDVY QQEKARMGSA GLRVLALASG PELGQLTFLG LVGIIDPPRT 
           560        570        580        590        600
    GVKEAVTTLI ASGVSIKMIT GDSQETAVAI ASRLGLYSKT SQSVSGEEID 
           610        620        630        640        650
    AMDVQQLSQI VPKVAVFYRA SPRHKMKIIK SLQKNGSVVA MTGDGVNDAV 
           660        670        680        690        700
    ALKAADIGVA MGQTGTDVCK EAADMILVDD DFQTIMSAIE EGKGIYNNIK 
           710        720        730        740        750
    NFVRFQLSTS IAALTLISLA TLMNFPNPLN AMQILWINII MDGPPAQSLG 
           760        770        780        790        800
    VEPVDKDVIR KPPRNWKDSI LTKNLILKIL VSSIIIVCGT LFVFWRELRD 
           810        820        830        840        850
    NVITPRDTTM TFTCFVFFDM FNALSSRSQT KSVFEIGLCS NRMFCYAVLG 
           860        870        880        890        900
    SIMGQLLVIY FPPLQKVFQT ESLSILDLLF LLGLTSSVCI VAEIIKKVER 
           910 
    SREKIQKHVS STSSSFLEV
    Length:919
    Mass (Da):100,577
    Last modified:June 21, 2005 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C1495D58FDA7EA1
    GO
    Isoform 2 (identifier: P98194-2) [UniParc]FASTAAdd to basket
    Also known as: ATP2C1B, ATP2C1C1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         877-919: DLLFLLGLTSSVCIVAEIIKKVERSREKIQKHVSSTSSSFLEV → GLALGEEWTAAG

    Show »
    Length:888
    Mass (Da):96,960
    Checksum:i27E2B0E13378BB98
    GO
    Isoform 3 (identifier: P98194-3) [UniParc]FASTAAdd to basket
    Also known as: ATP2C1B1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1-16: Missing.
         910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV

    Show »
    Length:923
    Mass (Da):101,163
    Checksum:iA7962E652B936D76
    GO
    Isoform 4 (identifier: P98194-4) [UniParc]FASTAAdd to basket
    Also known as: ATP2C1A1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1-16: Missing.

    Show »
    Length:903
    Mass (Da):98,733
    Checksum:iD15118E067B15ED4
    GO
    Isoform 5 (identifier: P98194-5) [UniParc]FASTAAdd to basket
    Also known as: ATP2C1B1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV

    Show »
    Length:939
    Mass (Da):103,007
    Checksum:iE6B6914D20DFD0B7
    GO
    Isoform 6 (identifier: P98194-6) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         919-919: V → VSSTSSSFLEVWLWERSGQQLVEIHPHLETGLPLTEDVSCV

    Show »
    Length:959
    Mass (Da):105,057
    Checksum:iC25B54ABDE014607
    GO
    Isoform 7 (identifier: P98194-7) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-2: MK → MDSLLPPSRFSYFKKYPLHAIRRYLSTLRNQRAEEQ
         910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV

    Show »
    Length:973
    Mass (Da):107,143
    Checksum:i0AC81DFDBA5DAB98
    GO
    Isoform 8 (identifier: P98194-8) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-2: MK → MDSLLPPSRFSYFKKYPLHAIRRYLSTLRNQRAEEQ
         39-77: Missing.
         919-919: V → VWLWERSGQQLVEIHPHLETGLPLTEDVSCV

    Show »
    Length:944
    Mass (Da):103,524
    Checksum:i16F4A201591E4EA8
    GO
    Isoform 9 (identifier: P98194-9) [UniParc]FASTAAdd to basket
    Also known as: ATP2C1D1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         919-919: V → VWLWERSGQQLVEIHPHLETGLPLTEDVSCV

    Show »
    Length:949
    Mass (Da):104,032
    Checksum:iDA7EBA526743BEDF
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    B4E2Q0B4E2Q0_HUMAN
    Calcium-transporting ATPase
    ATP2C1 hCG_14809
    		953Annotation score:

    Annotation score:3 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y9V7H0Y9V7_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		903Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y9S7H0Y9S7_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		314Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    D6R9U9D6R9U9_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		131Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    D6REJ1D6REJ1_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		102Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    D6RHV9D6RHV9_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		120Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    D6RGE9D6RGE9_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		82Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y8X9H0Y8X9_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		215Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YAH2H0YAH2_HUMAN
    Calcium-transporting ATPase type 2C...
    ATP2C1
    		50Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA92585 differs from that shown. Reason: Frameshift.Curated
    The sequence BAC11142 differs from that shown. Reason: Erroneous initiation.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti62E → K in AAF26295 (PubMed:10615129).Curated1
    Sequence conflicti62E → K in AAF26296 (PubMed:10615129).Curated1
    Sequence conflicti112I → F in AAF35375 (PubMed:10767338).Curated1
    Sequence conflicti150T → I in BAC11142 (PubMed:14702039).Curated1
    Sequence conflicti346V → A in BAH12365 (PubMed:14702039).Curated1
    Sequence conflicti373A → T in AAF26295 (PubMed:10615129).Curated1
    Sequence conflicti373A → T in AAF26296 (PubMed:10615129).Curated1
    Sequence conflicti516R → H in CAA09425 (PubMed:11124703).Curated1
    Sequence conflicti713A → T in BAC11142 (PubMed:14702039).Curated1
    Sequence conflicti868F → L in BAG61775 (PubMed:14702039).Curated1
    Sequence conflicti901S → G in BAC11142 (PubMed:14702039).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_010130201P → L in HHD; has normal catalytic cycle. 2 Publications1
    Natural variantiVAR_079698220G → E in HHD. 1 Publication1
    Natural variantiVAR_008803304A → T in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853012EnsemblClinVar.1
    Natural variantiVAR_022672309G → C in HHD; impairs manganese-dependent autophosphorylation in the presence of ATP; impairs manganese transporter activity. 3 Publications1
    Natural variantiVAR_079699309G → V in HHD. 1 PublicationCorresponds to variant dbSNP:rs1393570830Ensembl.1
    Natural variantiVAR_008804318L → P in HHD. 1 Publication1
    Natural variantiVAR_022673341L → P in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_010131344C → Y in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_022674411C → R in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_048373450A → T. Corresponds to variant dbSNP:rs41434650EnsemblClinVar.1
    Natural variantiVAR_019523490C → F in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853014EnsemblClinVar.1
    Natural variantiVAR_010132570T → I in HHD; decreases protein expression. 2 Publications1
    Natural variantiVAR_022675580I → V in HHD; impairs phosphoenzyme dephosphorylation. 2 PublicationsCorresponds to variant dbSNP:rs1282232888Ensembl.1
    Natural variantiVAR_019524584L → P in HHD. 1 PublicationCorresponds to variant dbSNP:rs137853015EnsemblClinVar.1
    Natural variantiVAR_079700609 – 919Missing in HHD. 1 PublicationAdd BLAST311
    Natural variantiVAR_008805641M → R in HHD. 1 Publication1
    Natural variantiVAR_008806645G → R in HHD. 1 Publication1
    Natural variantiVAR_008807709T → M in HHD. 1 PublicationCorresponds to variant dbSNP:rs778865612Ensembl.1
    Natural variantiVAR_079701730 – 731Missing in HHD. 1 Publication2
    Natural variantiVAR_079702731A → D in HHD. 1 Publication1
    Natural variantiVAR_022676742D → Y in HHD; impairs calcium- and manganese-dependent autophosphorylation. 2 Publications1
    Natural variantiVAR_008808744P → R in HHD. 1 Publication1
    Natural variantiVAR_022677789G → R in HHD; decreases protein expression. 2 Publications1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0004081 – 16Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST16
    Alternative sequenceiVSP_0458921 – 2MK → MDSLLPPSRFSYFKKYPLHA IRRYLSTLRNQRAEEQ in isoform 7 and isoform 8. 1 Publication2
    Alternative sequenceiVSP_05503639 – 77Missing in isoform 8. 1 PublicationAdd BLAST39
    Alternative sequenceiVSP_000409877 – 919DLLFL…SFLEV → GLALGEEWTAAG in isoform 2. 2 PublicationsAdd BLAST43
    Alternative sequenceiVSP_000410910 – 919SSTSSSFLEV → WLWERSGQQLVEIHPHLETG LPLTEDVSCV in isoform 3, isoform 5 and isoform 7. 3 Publications10
    Alternative sequenceiVSP_014102919V → VSSTSSSFLEVWLWERSGQQ LVEIHPHLETGLPLTEDVSC V in isoform 6. 2 Publications1
    Alternative sequenceiVSP_055037919V → VWLWERSGQQLVEIHPHLET GLPLTEDVSCV in isoform 9 and isoform 8. 1 Publication1

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		AF181120 mRNA Translation: AAF26295.1
    AF181121 mRNA Translation: AAF26296.1
    AF189723 mRNA Translation: AAF27813.2
    AF225981 mRNA Translation: AAF35375.1
    AY268374 mRNA Translation: AAP30008.1
    AY268375 mRNA Translation: AAP30009.1
    AB037768 mRNA Translation: BAA92585.1 Frameshift.
    AK001684 mRNA Translation: BAA91835.1
    AK074692 mRNA Translation: BAC11142.1 Different initiation.
    AK296470 mRNA Translation: BAH12365.1
    AK299945 mRNA Translation: BAG61775.1
    AK314342 mRNA Translation: BAG36984.1
    AC055733 Genomic DNA No translation available.
    AC097105 Genomic DNA No translation available.
    CH471052 Genomic DNA Translation: EAW79218.1
    CH471052 Genomic DNA Translation: EAW79219.1
    BC028139 mRNA Translation: AAH28139.1
    AJ010953 mRNA Translation: CAA09425.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS33856.1 [P98194-9]
    CCDS46912.1 [P98194-5]
    CCDS46913.1 [P98194-2]
    CCDS46914.1 [P98194-1]
    CCDS56278.1 [P98194-7]
    CCDS56279.1 [P98194-8]
    CCDS56280.1 [P98194-3]
    CCDS56281.1 [P98194-4]

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001001485.1, NM_001001485.2 [P98194-2]
    NP_001001486.1, NM_001001486.1 [P98194-9]
    NP_001001487.1, NM_001001487.1 [P98194-5]
    NP_001186108.1, NM_001199179.1 [P98194-1]
    NP_001186109.1, NM_001199180.1 [P98194-7]
    NP_001186110.1, NM_001199181.1
    NP_001186111.1, NM_001199182.1 [P98194-8]
    NP_001186112.1, NM_001199183.1 [P98194-3]
    NP_001186113.1, NM_001199184.1 [P98194-4]
    NP_001186114.1, NM_001199185.1 [P98194-2]
    NP_055197.2, NM_014382.3 [P98194-1]
    XP_005247412.1, XM_005247355.2
    XP_005247413.1, XM_005247356.2
    XP_016861653.1, XM_017006164.1

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000328560; ENSP00000329664; ENSG00000017260 [P98194-2]
    ENST00000359644; ENSP00000352665; ENSG00000017260 [P98194-9]
    ENST00000422190; ENSP00000402677; ENSG00000017260 [P98194-5]
    ENST00000428331; ENSP00000395809; ENSG00000017260 [P98194-1]
    ENST00000504381; ENSP00000425320; ENSG00000017260 [P98194-8]
    ENST00000504948; ENSP00000423330; ENSG00000017260 [P98194-4]
    ENST00000507488; ENSP00000421326; ENSG00000017260 [P98194-7]
    ENST00000508532; ENSP00000424783; ENSG00000017260 [P98194-1]
    ENST00000510168; ENSP00000427461; ENSG00000017260 [P98194-1]
    ENST00000513801; ENSP00000422872; ENSG00000017260 [P98194-3]
    ENST00000533801; ENSP00000432956; ENSG00000017260 [P98194-2]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		27032

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:27032

    UCSC genome browser

    More...    UCSCi    		uc003enk.4, human [P98194-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		AF181120 mRNA Translation: AAF26295.1
    AF181121 mRNA Translation: AAF26296.1
    AF189723 mRNA Translation: AAF27813.2
    AF225981 mRNA Translation: AAF35375.1
    AY268374 mRNA Translation: AAP30008.1
    AY268375 mRNA Translation: AAP30009.1
    AB037768 mRNA Translation: BAA92585.1 Frameshift.
    AK001684 mRNA Translation: BAA91835.1
    AK074692 mRNA Translation: BAC11142.1 Different initiation.
    AK296470 mRNA Translation: BAH12365.1
    AK299945 mRNA Translation: BAG61775.1
    AK314342 mRNA Translation: BAG36984.1
    AC055733 Genomic DNA No translation available.
    AC097105 Genomic DNA No translation available.
    CH471052 Genomic DNA Translation: EAW79218.1
    CH471052 Genomic DNA Translation: EAW79219.1
    BC028139 mRNA Translation: AAH28139.1
    AJ010953 mRNA Translation: CAA09425.1
    CCDSiCCDS33856.1 [P98194-9]
    CCDS46912.1 [P98194-5]
    CCDS46913.1 [P98194-2]
    CCDS46914.1 [P98194-1]
    CCDS56278.1 [P98194-7]
    CCDS56279.1 [P98194-8]
    CCDS56280.1 [P98194-3]
    CCDS56281.1 [P98194-4]
    RefSeqiNP_001001485.1, NM_001001485.2 [P98194-2]
    NP_001001486.1, NM_001001486.1 [P98194-9]
    NP_001001487.1, NM_001001487.1 [P98194-5]
    NP_001186108.1, NM_001199179.1 [P98194-1]
    NP_001186109.1, NM_001199180.1 [P98194-7]
    NP_001186110.1, NM_001199181.1
    NP_001186111.1, NM_001199182.1 [P98194-8]
    NP_001186112.1, NM_001199183.1 [P98194-3]
    NP_001186113.1, NM_001199184.1 [P98194-4]
    NP_001186114.1, NM_001199185.1 [P98194-2]
    NP_055197.2, NM_014382.3 [P98194-1]
    XP_005247412.1, XM_005247355.2
    XP_005247413.1, XM_005247356.2
    XP_016861653.1, XM_017006164.1

    3D structure databases

    SMRiP98194
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGRIDi117963, 51 interactors
    IntActiP98194, 27 interactors
    MINTiP98194
    STRINGi9606.ENSP00000421326

    Chemistry databases

    DrugBankiDB01373, Calcium
    DB01189, Desflurane
    DB00228, Enflurane
    DB00753, Isoflurane
    DB01028, Methoxyflurane
    DB01236, Sevoflurane

    Protein family/group databases

    TCDBi3.A.3.2.5, the p-type atpase (p-atpase) superfamily

    PTM databases

    iPTMnetiP98194
    MetOSiteiP98194
    PhosphoSitePlusiP98194
    SwissPalmiP98194

    Genetic variation databases

    BioMutaiATP2C1
    DMDMi68068024

    Proteomic databases

    EPDiP98194
    jPOSTiP98194
    MassIVEiP98194
    MaxQBiP98194
    PaxDbiP98194
    PeptideAtlasiP98194
    PRIDEiP98194
    ProteomicsDBi33752
    34290
    57820 [P98194-1]
    57821 [P98194-2]
    57822 [P98194-3]
    57823 [P98194-4]
    57824 [P98194-5]
    57825 [P98194-6]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		4128, 335 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		27032

    Genome annotation databases

    EnsembliENST00000328560; ENSP00000329664; ENSG00000017260 [P98194-2]
    ENST00000359644; ENSP00000352665; ENSG00000017260 [P98194-9]
    ENST00000422190; ENSP00000402677; ENSG00000017260 [P98194-5]
    ENST00000428331; ENSP00000395809; ENSG00000017260 [P98194-1]
    ENST00000504381; ENSP00000425320; ENSG00000017260 [P98194-8]
    ENST00000504948; ENSP00000423330; ENSG00000017260 [P98194-4]
    ENST00000507488; ENSP00000421326; ENSG00000017260 [P98194-7]
    ENST00000508532; ENSP00000424783; ENSG00000017260 [P98194-1]
    ENST00000510168; ENSP00000427461; ENSG00000017260 [P98194-1]
    ENST00000513801; ENSP00000422872; ENSG00000017260 [P98194-3]
    ENST00000533801; ENSP00000432956; ENSG00000017260 [P98194-2]
    GeneIDi27032
    KEGGihsa:27032
    UCSCiuc003enk.4, human [P98194-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		27032
    DisGeNETi27032

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		ATP2C1
    HGNCiHGNC:13211, ATP2C1
    HPAiENSG00000017260, Low tissue specificity
    MalaCardsiATP2C1
    MIMi169600, phenotype
    604384, gene
    neXtProtiNX_P98194
    OpenTargetsiENSG00000017260
    Orphaneti2841, Familial benign chronic pemphigus
    PharmGKBiPA25111
    VEuPathDBiHostDB:ENSG00000017260.19

    Human Unidentified Gene-Encoded large proteins database

    More...    HUGEi    		Search...

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG0202, Eukaryota
    GeneTreeiENSGT00940000156421
    HOGENOMiCLU_002360_3_3_1
    InParanoidiP98194
    OMAiVGMSDPP
    OrthoDBi100699at2759
    PhylomeDBiP98194
    TreeFamiTF354251

    Enzyme and pathway databases

    BRENDAi7.2.2.10, 2681
    PathwayCommonsiP98194
    ReactomeiR-HSA-936837, Ion transport by P-type ATPases
    SIGNORiP98194

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		27032, 48 hits in 997 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		ATP2C1, human

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		ATP2C1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		27032
    PharosiP98194, Tbio

    Protein Ontology

    More...    PROi    		PR:P98194
    RNActiP98194, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000017260, Expressed in corpus callosum and 241 other tissues
    ExpressionAtlasiP98194, baseline and differential
    GenevisibleiP98194, HS

    Family and domain databases

    Gene3Di3.40.1110.10, 1 hit
    3.40.50.1000, 1 hit
    InterProiView protein in InterPro
    IPR030336, ATP2C1
    IPR006068, ATPase_P-typ_cation-transptr_C
    IPR004014, ATPase_P-typ_cation-transptr_N
    IPR023299, ATPase_P-typ_cyto_dom_N
    IPR018303, ATPase_P-typ_P_site
    IPR023298, ATPase_P-typ_TM_dom_sf
    IPR008250, ATPase_P-typ_transduc_dom_A_sf
    IPR036412, HAD-like_sf
    IPR023214, HAD_sf
    IPR006413, P-type_ATPase_IIA_PMR1
    IPR001757, P_typ_ATPase
    IPR044492, P_typ_ATPase_HD_dom
    PANTHERiPTHR42861:SF2, PTHR42861:SF2, 1 hit
    PfamiView protein in Pfam
    PF00689, Cation_ATPase_C, 1 hit
    PF00690, Cation_ATPase_N, 1 hit
    PRINTSiPR00120, HATPASE
    SFLDiSFLDF00027, p-type_atpase, 1 hit
    SMARTiView protein in SMART
    SM00831, Cation_ATPase_N, 1 hit
    SUPFAMiSSF56784, SSF56784, 1 hit
    SSF81653, SSF81653, 1 hit
    SSF81665, SSF81665, 1 hit
    TIGRFAMsiTIGR01522, ATPase-IIA2_Ca, 1 hit
    TIGR01494, ATPase_P-type, 3 hits
    PROSITEiView protein in PROSITE
    PS00154, ATPASE_E1_E2, 1 hit

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2C1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P98194
    Secondary accession number(s): B2RAT7
    , B4DSW3, B7Z3X9, G3XAH8, G8JLN9, O76005, Q86V72, Q86V73, Q8N6V1, Q8NCJ7
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: June 21, 2005
    Last modified: June 2, 2021
    This is version 215 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with genetic variants
      List of human entries with genetic variants
    3. Human variants curated from literature reports
      Index of human variants curated from literature reports
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again